current user: public

If you have questions about the server, please let us know.

Query: 5x41_Q mol:protein length:256 Uncharacterized protein CbiQ, from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MGSSGSMSIASIDRVAAQGHWRSRPLAEKSLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARVPLRFWASVAVLPLGFLTTGAAVLLIQIGPEGIGLAPDGPAKAAALVMRATAATCCLLFLATTTPAADLLSGLRRWRVPAELIEIALLTYRFVFILAEEAAAMTTAQRARLGHATRRRWLRSTAQVIAALLPRALTRARRLETGLGARNWQGEMRVLSTRPPASARVLGLILTLQAAILAAGVLLLast
1 -58.200[P] COG0619 ABC-type cobalt transport system, permease component CbiQ and related transporters  ali follow..  17  1.....MIGARSIAEPTIKDTIIHRMDPRAKILILISTVFVAVTLDNPETMLLLFLIILSGFALARMPAIKLKTLAILLTLLIWGTIYSQALFLTSGGLFVYAEGLHHGAIQGLRSASILSLGLLMCWTTDSRDMLNGLVGLKVPYSAAFMVVTAVRFLPIIITEVLTVVTVQRLRGFNRFGSGIVKTSLNILTPTLSNCVRRTGTLAVSIQSRAFRANPDYLKKLKFSEFDKAVVAVCIFAAISIVLIKL 271
2 -8.760[S] KOG4502 Predicted membrane protein  ali follow..  12  531..........................PKTVKRSSLVYQILLSLQKTLSIVYFLVIFILYFYKGAILPYPRYVRVMEFFVIIPFIPIEYLRINWGSRG-NLLESTAFLALSTVLSIPIIIILVYLEFFQNYVLFI----------EEIFTYVMGFFVILETLLS----VLTITFSSSG......................................................................... 667
3 -6.640[S] KOG2568 Predicted membrane protein  ali follow..  169.................................................MSLAYLLLSAVWFFQYLRFRMDILPLQHCITAVILLGLLEMLFWYLDYANFNHTGMRPLALTTWVVTIGALRKTVSRILILCVSMGFGVVKSTLGGLTSKVLLVGVTYFIASEILDIAEHVGIIDDMSGRSKLFLVLPDAFLDAFLILWIFTSLSKTLEQLQMKRTSVKLEIYRK--------FSNALAVMVVASVAWIVY 361
4 -6.640[BK] KOG3001 Dosage compensation regulatory complex/histone acetyltransferase complex, subunit MSL-3/MRG15/EAF3, and related CHROMO domain-containing proteins  ali follow..  14  577.................................................................................................................KWSFQLNELDNMNSTERISFLQEKLQEIR-------------KYYMSLKSEVATIDRRRK-RLKKKDREVSHAGASMSSASSDTGSSSSPPQNVLAVECR..................................... 665
5 -6.510[S] KOG4829 Uncharacterized conserved protein  ali follow..  11  201.....................................................................................................................................QQTAFDVEKLDDELWPTA---LEYL--ISQLAEEVIQKLDKEGEKLEDEAERRKLIE-------TQYRRARDLLQSF........................................ 276
6 -6.270[T] KOG2830 Protein phosphatase 2A-associated protein  ali follow..  10  41.....................................................................................................QEKVFKGLDLLDKVAKMLSQLDLFSRNEDLEEISTDLKYLMVPAFQGALTM--------QVNPRKRLDHLQQAREHFIKYLTQCHYYRVAYPSLVAMASQRQAKIERYKQKKVLEHKLSTMKSAVESGQADNERVREYYLLHLQRWID. 204
7 -6.210[S] KOG4448 Uncharacterized conserved protein, contains phosphotyrosine interaction (PI) domain  ali follow..  11  263.............................................................................................................EFKVSYLGNVLTGWA-CVEKQLNTLWRNYTQHSKPDVIMRLKVITY-FCWIYRHEGRKLKHELRCHAVLCSKEKIAQDICDTLRENLESALREFKREKILKQNA..................................... 399
8 -6.190[J] KOG2147 Nucleolar protein involved in 40S ribosome biogenesis  ali follow..  10  527........LFLATEALCSAKCANLNALAKQIQLANAIVEYVSESKRYVPELVAFARSALLLAVTEKSEKFATNGFPISKPHTEMLCFEEKLLFLTKNYNWISQK-LHVLRALLSLIQHLRVIYYSIVFKPFLRILESIQAKNLPAEVQEELETLCASMKAEIPKDEKKKLTKNLRNERRGAIKELRKDTAFLARKQLSS-AATKRVMGGLMQQ--QGEWNKEKRTADVEKK................... 844
9 -5.990[A] KOG3948 Mediator of U snRNA nuclear export PHAX  ali follow..  11  231..................................................................................................................................ADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRT--------GGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARK................... 324
10 -5.910[S] KOG4556 Predicted membrane protein  ali follow..  12  7.................................................LSLLLATWTLLSIARLV--------------FDLIGNLWVVVVFDFVQIVLLISGLFGATQKRRPLLYTLLSSNALSVTINVLIFLWYIGVFGEISRPYLSAGLPYSSSF--------LRFTPYCDAEFDVIRKKWVQKQCLIPFYSVEASQAILHIIFAIVT...................................... 148

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24