current user: public

If you have questions about the server, please let us know.

Query: 1cev_A mol:protein length:299 PROTEIN (ARGINASE), from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLMLast
1 -5.390IDP02649 putative glutamic dehyrogenase-like protein [Salmonella typhimurium LT2] STM1795 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  118..KCAALNLPY--GGAKGGIRVDPFSLSEGELERLTRRYTSEIGII--IGPQKDIPAPDVG-TNGKVMAWMMDTYSMNHGTTVTGVVTGK-PIHLGGSLGREKATGRGVFVSGLEA-ARRANIAVEGARVAVQGFGNVGSEAARLFAGAGARVVAIQDHTATLFNATGIDMKALTAWQTEHKQIAGFPGAETIASDAFWRLEMDILIPAALEGQITRQRAEALTCKL-VLEGANGP---YPDADDVLASRGILVVPDVVCNAGGVTVSYFEWVQDMASFFWSEEEINARMDKIMTDAI. 403
2 -5.170IDP92108 NADP-specific glutamate dehydrogenase, putative [Toxoplasma gondii ME49] TGME49_093180 [Toxoplasma gondii ME49]  ali follow..  13  152..KNSLTGLSI--GGAKGGSDFDPKGRSDNEVMRFCQAFMTELSRY--IGPNRDVPAGDIG-VGAREIGYLFGQYKLLKAGQFEGALTGK-DKNWGGSAMRPEATGYGCVYFVLELLKAQNKEGIKGMRCAISGSGNVALYAGEKLATLGAKVMTFSDSSGYIVNEKGFPLGQIQRLKEMKETRSSQNEISEEDAQLLIDNGCRIVAEGANMPTTRDAIRLFKQHGV-ILCPGKAANAGGVAVSGLEMSQNAVVDEKLRQIMASIFSKCRSYAAKFGENEFDLVTGANVA......... 474
3 -5.130IDP92759 gene: csy1; Csy1 [Vibrio phage ICP1_2011_A] AGG09391 [Vibrio phage ICP1_2011_A]  ali follow..  15  1............................................................................MIKEMIEDFISKGGLIFTHSGRYTNTNNSCFIFNKND-----IGVDTKVDMYTPKSAGIKNEEGENLWQVLNKANMFYRIYSGELGEELQYLLKSCCTAKEDVTTLPQIYFKNGEGYDI--LVPIGNAHNLISGTEYLWEHKYYNTFTQKLGGSNPQNCTHACNKMRGGFKQ................................................... 165
4 -5.000IDP02130 putative sugar nucleotidyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1416c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  1MNAIILAA---------FGSRLMPEALKSAGINEIAVVGGYLNDVLKNY--LNKYDIEHFFINSKYDKTNMVHTFFCAKDFMLKCIEEKQDLIISYADIVYFQDCVQKLINAKEELAIV-----VDKSWCKLWSKRFANPLEDAETLKMTNGYIIELGKKANAYDEIEAQYIGLFKFSYQFLSEVIAFYEMLDRDILYDNKNFENMMTSFLQALIEKYNNAKAVCEIDFMS.................................................................... 245
5 -4.670IDP02337 gene: gdhA; glutamate dehydrogenase [Bacillus anthracis str. `Ames Ancestor`] GBAA1511 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  108..KCGIVDLPY--GGGKGGIICDPREMSFRELERLSRGYVRAISQI--VGPTKDIPAPDVF-TNSQIMAWMMDEYSRIDEFNSPGFITGK-PLVLGGSHGRETATAKGVTICIREA-AKKRDIDIKGARVVVQGFGNA-GSFLAKFMHDAGAKVIAISDAYGALHDPNGLDIDYLLDRRDSFGTVTKLFNNTISNKELLELDCDILVPAAIENQITEENANDIKAKI-VVEAANGP---TLEATKILTDRGILLVPDVLASAGGVTVSYFEWVQNNQGYYWTEEEVEQRLEKVMVRSF. 392
6 -4.650IDP04177 shikimate kinase [Vibrio cholerae O1 biovar El Tor str. N16961] VC2629 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  1.....................................................................................MAEKRNIFLVGGAGKSTIGRHLA-----QQLHMEFIDSDTVIEERT--------GADIAWVFDVE----------------------GEEGFRKREEAVIND--LTEQQGIVLATGGGSVISKENRNRLSARGIVVYLETTIEKQLARTNRDKKRPL---LQTDCPREVLEQLAEDRNPLYEEIADI--TVRTDDQSAKVVANQIVKMLEEHIM 174
7 -4.650IDP02096 gene: prk; phosphoribulokinase 1 [Yersinia pestis CO92] YPO0178 [Yersinia pestis CO92]  ali follow..  1.....................................................................................MSTKHPVIAVTGSSGAGTTTTSLFQQLDIRAAQIEGDSF--IRKARDQGRHISYFGPEANDFGQLEQSVAEYSKHGTGRSRKYLHTYDEAVPYNQIPGTFTPWEPLPEPTDVLFYEGLHGGVVTEHHDVAKHVDLVGVVPIVNL-DTGER---------GHSREAVMDSVVRSMDDYI--------ITPQFSRTHINFQRV............. 208
8 -4.570IDP01891 gene: prkB; putative phosphoribulokinase [Salmonella typhimurium LT2] STM3464 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1.....................................................................................MSAKHPVIAVTGSSGAGTTTTSLFAQLNLHAAEVEGDSFMAIRKARDAGRHISYFGPEANDFSLLEHTFIEYGQTGKGQSRKYLHTYDEAVPWNQVPGTFTPWQPLPEPTDVLFYEGLHGGVVTPQHDVARHVDLVGVVPIVNL-DTSER---------GHSREAVMDSVVRSMDDYI--------ITPQFSRTHIN................. 204
9 -4.530IDP92010 TFIIH basal transcription factor complex helicase XPB subunit, putative [Toxoplasma gondii ME49] TGME49_069660 [Toxoplasma gondii ME49]  ali follow..  489.ARSGIIVLPCGAGKTLTGITLRKSVMILTTSAVAVDQWRKQFEEYTTID-KQTLWPVDEAGVLVSTYTMLAFSGRRAAERIMQQIREREWGLLIFDEQFAPAPAFRRINDLVKSHCRLGLTATLVREDDLIKDLQWLIG---PKLFEANWIELQD----QGFLARVSCQEVWCPMTADFYREYLRCSHAKQRKLWVCNPTKLMTCEWLLRYHEARGDKILVFSDNVFALLHTAKALNRPFIYGQVSAVERVAILNKFKHESTFNAIDIPCANVVIQISFNFA--SRRQEAQRLGRIL. 803
10 -4.490IDP90276 patatin-like phospholipase domain-containing protein [Toxoplasma gondii ME49] TGME49_032600 [Toxoplasma gondii ME49]  ali follow..  16  1..............................................................................................MKGN-SVSLRSLS--------FSLLLFSFCMDTRSSATDGADKAESAVSAA------------SAEEPSGEDASESSLGEDEEDSEEEDENEDEDFSSLLGGGGFGRGLDNLMSGLFDNLGTDSDGEHKLGNLASL----LPNLGMIGKGGGDGKEELAELLSKASAQQNSGTNQVSPDFVNQIFSMLSKNNTAL.......... 181

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.