Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: 5lzs_l mol:protein length:51 Uncharacterized protein, from PDB1018

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst MSSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGLLast
1 -5.220IDP91486 hypothetical protein VP1698 [Vibrio parahaemolyticus RIMD 2210633] VP1698 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  50  4...................................RTQMKKQHWRRRSL.. 17
2 -3.370IDP06148 hypothetical protein jhp1155 [Helicobacter pylori J99] NP_223873 [Helicobacter pylori J99]  ali follow..  17  95............LATATAFSQCAPIYTVLLSPLLLKEKLKRSALISACIGL 133
3 -3.340IDP02819 gene: yfeD; putative negative regulator [Salmonella typhimurium LT2] STM2414 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  1MKRLRSKMTTEELAECL-------------ARQTVNRWIREQHWKTEKF.. 38
4 -3.180IDP95257 CPS-53 prophage bactoprenol glucosyl transferase [Acinetobacter baumannii ATCC 17978] YP_001085643 [Acinetobacter baumannii ATCC 17978]  ali follow..  16  53LLDAKVVEAIKQLPEKNRYMKGLYAWVGFKS-IGINFSEQERQHGHSSFNL 102
5 -3.170IDP05270 gene: gbuC; hypothetical protein lmo1016 [Listeria monocytogenes EGD-e] lmo1016 [Listeria monocytogenes EGD-e]  ali follow..  23  20LQTSSTAAMTSTLQKAMKDKRPIPHWMFTKFDLKFLDDPKNVYGNAENIHT 76
6 -3.160IDP92610 gene: srr-2; serine-rich repeat protein [Streptococcus agalactiae] AAZ95526 [Streptococcus agalactiae]  ali follow..  18  1............MLKKQFGN-----FGEKSRKVRVKMRKSGKHWVKSVMT. 33
7 -3.100IDP00508 putative hydrolase YPO1315 [Yersinia pestis CO92]  ali follow..  13  151YQKGKVDRLNQWLSASPQLNEYVDHAAVINPGAELIDLAVLHQWD...... 212
8 -3.030IDP00186 putative membrane protein YPO0695 [Yersinia pestis CO92]  ali follow..  13  110........VGLLINRVDIQKRGVPYAVAITAGFLSSV.............. 138
9 -3.030IDP92647 gene: AadB; aminoglycoside adenylyltransferase, streptothricin and spectinomycin resistance protein TNCP6 [Pseudomonas aeruginosa]  ali follow..  50  2.......................................RSRNWSRT.... 9
10 -2.790IDP06193 gene: lpp20; lipoprotein [Helicobacter pylori J99] NP_224067 [Helicobacter pylori J99]  ali follow..  15  23.SHAPKSGISKSNKAYKEATKGAPDWV........................ 48
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;