current user: public

If you have questions about the server, please let us know.

Query: 1wva_A mol:protein length:322 Arginase 1, from PDB1018

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLast
1 -98.800sp|P05089|ARGI1_HUMAN Arginase-1 OS=Homo sapiens GN=ARG1 PE=1 SV=2  ali follow..  100  1MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK 322
2 -90.200sp|P78540|ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens GN=ARG2 PE=1 SV=1  ali follow..  58  19LKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPS 341
3 -70.400sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2  ali follow..  24  67.SPEGLDAAFIGVPLDTGSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLG-----DVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALG-EKLYHGAPFRRCVDEG---------------LLDCKRVVQIGIRGSTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQM---GGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGL-NVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTT.............. 351
4 -5.880sp|Q13415|ORC1_HUMAN Origin recognition complex subunit 1 OS=Homo sapiens GN=ORC1L PE=1 SV=2  ali   13  207...........................................................................................................................................................................................................REQEFQDIYNFVESKLLDHTGGCMYIS----------VPGTGKTA----TVHEVIRCLQQAAQANDVPPFQYIEVN--------MKLTEPHQVYVQILQKLTGQKATANHAAE...... 299
5 -5.850sp|P43304|GPDM_HUMAN(removed signalp:1-23) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens GN=GPD2 PE=1 SV=3  ali   16  35................................................................................EAQLLTLQNTSEFILVIGGG---ATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHG-----------------------------------GVRYLQKAIMKLDIEQ----------------RMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLYDLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVARMNLAIALTA................... 213
6 -5.640sp|Q9H3H1|MOD5_HUMAN tRNA dimethylallyltransferase, mitochondrial OS=Homo sapiens GN=TRIT1 PE=1 SV=1  ali follow..  10  19LQRTLPLVVILG-ATGTGKSTLALQLGQREIVSADSMQVYEGLDIITNKVSAQEQRICRHISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKP------EMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAA---------KLHPHDKRKV-ARSLQ-----VFEETGISH--SEFLHRQHTEEGGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGL-LEELRDFHRR-YQHGIFQSIGFKEFHEYLTEGKCTLETSNQLLKKGIEALKQVTKR............. 320
7 -5.610sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1  ali follow..  15  1.......................................................................................MAAPGALLVMGGSGKSTVGALLA-----SELGWKFYDA--DDYHPEENRRKMGKGIPL-----NDQDRIPWLCNLHILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLL----------VHLSGSFEVISGRLLKREGHFMPPEL-LQSQFETLEPPAAPENFIQISV............................................... 169
8 -5.520sp|P49448|DHE4_HUMAN Glutamate dehydrogenase 2, mitochondrial OS=Homo sapiens GN=GLUD2 PE=1 SV=2  ali follow..  13  171......KCAVVDVPF--GGAKAGVKINPKNYTENELEKITRRFTMELAKKGFIPGVDVPAPDMNTGEREMSWIADTYASTIGHYDHACVTGK-PISQGGISATGRGVFHGIENFINEASY---------------------------------------MSILGMTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGEWNPDGID--PKELEDFKLQHGSILGFLEVDCDILIPAAANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQES............. 473
9 -5.410sp|Q63HM9|PLCX3_HUMAN PI-PLC X domain-containing protein 3 OS=Homo sapiens GN=PLCXD3 PE=2 SV=2  ali follow..  13  16...............................................................................MATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPE-----------------------QPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVVFLDFN.......................................................................................... 145
10 -5.370sp|P00367|DHE3_HUMAN Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens GN=GLUD1 PE=1 SV=2  ali follow..  13  171......KCAVVDVPF--GGAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIPGIDVPAPDMSTGEREMSWIADTYASTIGHYDHACVTGK-PISQGGISATGRGVFHGIENFINEASYM---------------------------------------SILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGEWNPDGID--PKELEDFKLQHGSILGFLEADCDILIPAAANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQES............. 473

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.