current user: public

If you have questions about the server, please let us know.

Query: 1b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE), from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGRALast
1 -124.0001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model  100  1MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGRA 385
2 -110.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  41  2..ALSDRLELVSASEIRKLFDIA----AGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDRHYSIASLMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERS-WKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGLTSKKFSELMLEARVAVVPGSAFGGEGYVRISYATAYEKLEEAMDRMERVLKE. 385
3 -110.0001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  43  7..MVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS------YMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRG---DDVKFCERLLEKKVALVPGSAFLKPGFVRLSFATSIERLTEALDRIEDFLNS. 382
4 -108.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  42  2..KLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDQHLSIGAAAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDC---VQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAKTGRSSLDFCSELLQHQVATVPGAAFGADDCIRLSYATDLDTIKRGMERLEKFLHG. 386
5 -107.0003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  28  1MSLKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALEL-TDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAE----LQANLDVYKANRKLMLERLPKAGTRIAPPDGAFYVYADVSDLTDDSRAFAAEILKAGVAVTPGLDFDGAGTLRFSYARATADIEEGLDRLEAFMQA. 381
6 -107.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  32  7.KRFNKNLNKIEVSMIR----QFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTR-SNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGSHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDD---ALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVQGQDSFKFLQDFAEKAVAFIPGVAFGGEGYLRISYAASMETIKEAMKRLKEFMEQ. 390
7 -106.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  34  2...LSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD--------FTVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFNLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETE--REINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGE---DGREFAYKLLEKFVALTPGIGFGGKNYIRISYANSYENIKEGLERIKEFLNK. 370
8 -105.0002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  29  7MDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERI-YENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAI-PQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDS---FFDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELP--VEDAEEFARWMLTETTMVAPLRGFYGKKEIRIACVLEKDLLSRAIDVLMEGLKM. 395
9 -104.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  35  5..RASKRALSV-EYAIRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLTDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMD---YLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIEVGWKNDKEFVLDVLNAHVLFVHGSGFGGAGHFRAVFLPPIEILEEAMDRFEKFMKE. 396
10 -104.0005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  42  71..SLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPTHTSFASLMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSAYYNDSSSLALYFLKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKALEP. 468
11 -104.0005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  33  1MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEAT--AEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLDTGVAIAPGIDFDGGSFVRISFAGPSGDIEEALRRIGSWLPS. 387
12 -102.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  24  6.AKFKKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVDAHTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPG---WMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRQAGVVVTPGTEFSTADSVRLNFSQDHEAAVAAARRIVTLVER. 404
13 -101.0003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  28  29..FTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKI-GYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKVKGKDFRISHWLIELGVVAIPPTEFYAENLLRFAVCKDDAYLENAVERLKLLKDY. 446
14 -98.9001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  40  2..RLHPRTEAAKESIFPRMSGLA-----QRLGAVNLGQGFPSNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLARR-EGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG------WDAFRLVEARVALIPASAFYPKDLFRFAFCKTEEELHLALERLGRVVNS. 370
15 -98.8002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  23  15..MISNKLANIPDSYFGKTMGRK--IEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDD---FLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPP-GYDSEQFEQFLVEKSILVAPGKPFGGNRYVRISLALDDQKLDEAAIRLTELAYL. 396
16 -98.3004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  26  25..EKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDEHHSIAPLAPDLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAGLEMLASMRLCANVPAQHAIQTALGGYQSISE-FITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDAKRHDDQKMVLDFLQEKVLLVQGTAFNWPDHFRIVTLPRVDDIELSLSKFARFLSG. 421
17 -98.2001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  28  7..IPQSKLPQLGTTIFTQMSALA-----QQHQAINLSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ-PPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQGHASVLAHLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPE---HYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVTLDDVEFCQWLTEHGVAAIPLSVFCPHKLIRLCFAKKESTLLAAAERLRQL.... 386
18 -98.0001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  27  14..DLPKRYQGSTKSVWVEYIQLA-----AQYKPLNLGQGFPDYHAPKYALNALAAAANSPDNQYTRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIRICTLMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETELKPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSLARKDYRFTKWMTSVGLQGIPPSAFYGEDFVRYCFFKKDENLQKAAEILRKWKGSS 429
19 -97.4003ele_A mol:protein length:398 Amino Transferase  ali model follow..  24  3..VVNESMYQLVRSAIRELFEYGKAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPAD-TEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGATG--------DINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKALE--DDSNAFCEKAKEEDVLIVAADGFGCPGWVRISYCVDREMIKHSMPAFEKIYKK. 395
20 -97.1005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  29  1..ANAKRIEGLDSNVWVEFTKLA-----ADPSVVNLGQGFPDISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGTHVKIATLMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGPYDYKFVKWMTHKKLTAIPVSAFCFEKLVRFCFIKKDSTLDAAEEIFRAW.... 410
21 -96.9002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  26  3........RVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTTYYCLKSCTLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKE---VVRGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPE-GVDDLEFGLRLVERGVALAPGRGFGGKGFVRIALVRPLEELLEAAKRIREALD.. 376
22 -96.8004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  31  4.QLQARRLDGIDYNPWVEFVKLA-----SEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFNQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHISIASLMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRYDRRFVKWMINKGLVAIPVSIFYFDHYIRFCFVKDEATLQAMDEKLRKWKVE. 421
23 -96.4002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  33  2..ATVSRLRPYATTVFAEMSALA-----TRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHRHLPLAGFMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDA---WVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPLGDDSTEFCAALPKVGVAAIPMSAFCDPALVRFTFCKRDDTLDEAIRRLSVLAER. 395
24 -95.3002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  28  9..RRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGKAPSIMQVAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQ---CVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEPHLGSLEFAKKLLDAKVSVSPGIGFGGDDHVRFALIENRDRLRQAVRGIKAMFRA. 397
25 -93.7001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  24  4WDVSMSNHAGLVFNPIRTVSDNA-KPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEACNGYFPTVGSPEAREAVATWWRNELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKFTSVADFETVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQE---HLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDLEKKTDVEFFEKLLEENVQVLPGTIFHAPGFTRLTTTRPVEVYREAVERIKAFCQR. 412
26 -92.2002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  20  23KVSRNSNMSKLQAGPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGI--GDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTP--EGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQ--SSWDVFAEILKTHVVTTPGSGFGGEGFVRVSAFGHRENILEACRRFKQLYK.. 426
27 -92.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  20  38..QRNENFGKLRAGPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKATREGYSGYGAEQGQGALREAVASTFYGHAGRAA--DEIFISDGSKCDIAR-IQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDPKTIYEIADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQP--EGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGK--PSWDVFAEILRCNIVTTPGSGYGGEGFVRASAFGSRENILEAVRRFKEAYGK. 439
28 -90.8006DK6 Entity 1(prereleased)  ali follow..  22  7.NFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGN-ILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYLKGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPIPHSIFEIARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKRRHSTKFNGASYIVQKGAEALYTD--EGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITPGSGFGGEGYFRISAFNSRANVEEVCRRIAAL.... 410
29 -89.6003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  15  14.KQNELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSHPGE-YTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACNDGEYNFRDSVIEYGRKARIMKKMFLDNGFDGNEPLADGFYFT-VGYKGMDSSKLIEKFVRYGMCAITLKTTGRNEAMRICTSLLPESFPDLEKRLQMLNAEG 437
30 -88.7004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  21  39..VRNVNLEKLKNNPEINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHV--KSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLS--SGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGS--KSWDVFNEILNTHIITVPGSGFGGEEYLRISGFGRRDHIVEASKRLQNFFNT. 441
31 -88.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  21  2........MTFEPYPFERLRALLKEI-TPKKRGLDLGIGEPQFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEAAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRH----AEFFRNIYANNLKLARKIFKNT----LIYPYSFYVYLPVQ----NGENFAKTLYNEGIITLPALYLGGADYVRLALVYDTPLLEKPLEIIETYREN. 374
32 -87.8003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  25  21...RPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGFLSSREEIASYYHCP-EAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRSQRILGPCTIVQGALKSILC--RTPGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIEMEHENDVEFTERLVEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQ. 417
33 -87.7003jtx_A mol:protein length:396 aminotransferase  ali model follow..  24  1..GMNTLLKQLKPYPFARLHEAMQGISAEGMEAVPLHIGEPKHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRDGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGKPLGCLQASRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQH----VIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPD--GDDLAFARNLWKAAIQVLPGRFLAGEGYVRIALVADVATCVKAAEDIVSLYR.. 396
34 -87.0003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  25  4...RPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGYLSSREEVASYYHCP-EAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILQ--RTPQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIEMEHENDVEFTERLIEQSVHCLPATCFEYPNFFRVVITVPEVMMLEACSRIQEFCEQ. 400
35 -86.6003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  23  2..KRNPHFVSLTKNADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPLPKSIFEIARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ-----LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQANISDRDLFDFFLEYHIAITPGIGFGGSGFVRFSSLGKREDILAACERLQMAPAL. 392
36 -86.4004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  22  31FRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRFCQTKSKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNIFTSVADFDTVPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIARTLL--KCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNLSYKSDMEFYEKLLEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCER. 435
37 -84.9004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  21  14.HMSSLRPRREDPPVLEEWYRRH--LGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAG-----GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHADE---LIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFRELPQEVERFCLELLERRTLLVPGTAFGAPHGARLGFGGPQEDFRAGLDGLSRFLRE. 395
38 -84.7003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  19  52IKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPLDSPSFPEDAKARRILQACGGNSLGSYSASQGVNCIREDVAAYIRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDFHSFKKVLYEELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLSVRLCPPVSGQAAMDIVVNPPVASREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFIPMAPDMFYCMKLLEEGICVVPGSGFGGTYHFRMTILPPVEKLKTVLQKVKDFHIN. 486
39 -84.0003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  20  15VDNLNPKVLKCEYAVRGEIVIHAQRLQEQHPDLLQREEIKTLFSAISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKFHSFKKIVRPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNIPKASDESYASYKA---EKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQICANKAPDAFYALRLLESGIVVVPGSGFGGTWHFRCTILPQEDKIPAVISRFTVFHEA. 483
40 -82.8003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  18  77....YINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANN--YPVPDRCLVNTEKIINYFLQEKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFK--SIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYRLAEEQVDFLLKLAKNGVVLVDGVGFGAPGELRVSQANLPTEYALIGKQVLELLKE. 524
41 -81.5003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  24  1....GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTG-----VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELD--VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQE---ILERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIAV-DMPMEDFCLQLLEHGVLLVPGNRFERDGYVRLGFACEQETLIKGLEKLSQFLRR. 370
42 -78.9005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  16  6....................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQ-HGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGA-----DLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSR--DAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVER-VAFAGRTGTEVWEELQRHHVFALPCRQFHGDHMVRIALSRSTEPLEKSVQVLRTVLET. 375
43 -78.5006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  13  12GSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA-EEGLQATYEKRFTEAFFQLHRQPTAL--VKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID--ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPEYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVR--DSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKSVAWFRVDHPELTATDVHRLLSADGVYVLPGRYFYGDAYVRMALAREPEMFADAMALTRQVLDR. 404
44 -78.5001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  18  1MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFISVMEVVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGL-VSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLEAEMELWKKIVEVHLNISPGSSCHEPGWFRVCFANLPERLDLAMQRLKAFVGE. 431
45 -78.2003if2_A mol:protein length:444 Aminotransferase  ali model follow..  19  3..KFSKFGQKFQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDADNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDRIKQLSDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKDLPISTLDLYERLKAKGTLIVPSEYFFAHECIRMSIAADEQTLIDGIKVIGEVVRE. 439
46 -77.7002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  20  74VGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQ--SLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVQSSTGDMLFRIAETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRKMAD. 520
47 -77.3003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  20  74VGGLAKIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQ--SLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDVTSSTGDMLFRIAETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRQMAD. 520
48 -76.8003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  21  3..TFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNDLLRLSETVIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDLPITTELLYQRLKARGVLMVPGHYFFTHQCMRMNYVPEPDKIEAGVKILAEEIERA 413
49 -75.6002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  19  70...TVGVGGLAKLDGRFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG---CNYPVPPRMLTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMAYIFSGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQ--SLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESA------KKALDHRYRSLLPD---VRSLKFIDRLVADSRVVALNHTGLSTPQQVQNYYTLIDLQNVQSSTGDMLFRVAETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRRLAD. 519
50 -73.6001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  19  2...LSKLATNEEHGENSPYFDGWKAYLKNPNGVIQMGLAENQLNPKGSICSEGIKSF-KAIANFQDYHGLPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTQFVSIAEILKDLVHIVYSLSKDMGLPGFRVGIIYSFDDVVNCARKMSSFGL--VSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPLLDSEMSLWRVIIDVKLNVSPGSSFEEPGWFRVCFANMDDGVDIALARIRRFVGV. 426
51 -66.5002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  15  8.QSLNEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMATNKDGKSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNP---NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYLTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQ-EQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHDV--DPEALRKHLIDKSIGVIALNATD----IRIAFSCEKDDIPHVFDSIAKAIDD. 428
52 -63.5003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  17  2..........VKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIDLMSYFSDMTNPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTP-----ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETENFFKYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYFGKSL-TKEETDLVSELRRHKVMSRAGERCGSKKHVRVSMLSREDVFNVFLERLANMKLI. 386
53 -63.1004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  19  7..TIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDDKGKSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGQQRKFFEKFSNFVVVAFSMSKSHTAYGLRSGAAVGIKEIIEEFEASLAHSARCNWSNGTHAAQNILIELERAEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTD----KAFDIVKDLEKENIFTIPSAKGI-----RVAICVGEEKIPKLVQRLAFYTNK. 412
54 -61.7003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  18  9...AKHAKGKKLKDVIFVTAGQAQAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEDEVRAFFNKFSHLTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPAEYEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD----SANAICEELKKEHIYVIAGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL.... 418
55 -61.3003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  19  1...MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGIIPQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQNYSSPPNFGAQVVAAVLNDEA---LKASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNQRGMTGLSAAQVDRLREEGVYLIASG--------RMCVAGNTANVQRVAKAFAAVM... 397
56 -60.8003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  18  1...MFENITAAPADPILGLADLFRADERP--GKINLGQGVYKDETGKSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQN--GMFSFSGLTKEQVLRLREFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL... 396
57 -60.7001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  12  30....GIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVRMSYFFNPVSNFIFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHY-----TPIKYKADEDILLFTMSKFTGHSGSRFGWAIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMRDLNTFGFKKLRERWVNITALLDQSDFSYQELPQSEYCYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFESSRYVRLSLIKTQDDFDQLMYYLKDMVKA. 424
58 -60.4001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  16  1...MLGNLKPQAPDKILALMGEFRADPRQGK--IDLGVGVYDATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLTVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEETRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMASFPPFHGAKIVSTVLTTPE---LRADWMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEHRGMLGATPEQVKRIKEEGIYMVGDS--------RINIAGNDNTIPILARAIIEVG... 393
59 -60.3004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  17  2..AMFEHIDAYPGDPILTLNENFQKDPRD--QKVNLSIGIYDAEGRIPVMGAVREARDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAV-RGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLASNPQTYGAKVVAAVLGTPA---LRKQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKMFTYTGLTESQVDALREVGVYILRSG--------RMCVAGNDSNVGIVADAIGKVLKSG 401
60 -60.2005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  16  1.SSWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQMYSNPPLNGARIAAAILNTPD---LRKQWLQEVKGMADRIIGMRTQLVNLKKEGSTHNWQHITDQIGMTGLKPEQVERLIEFSIYMTKDGRISVAGSSNVGYLA--HAIHQVTK......... 401
61 -59.9004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  17  4..GTFENITAAPADPILGLADLFRADERP--GKINLGIGVKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVNTLQEKGARDFSFIIKQNGMFSFSGL---TKEQVLRLREEGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL... 400
62 -59.5001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  17  1...MFENITATTADPILGLADLFRADERPGK--IDLGIGYKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDA---LRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREEGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL... 396
63 -59.0002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  17  1...MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYDETGKTPVLTSVKKAENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFQNGMFSFSGLTKEQVLRLREFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL... 396
64 -58.3004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1.......MAMGKPDPILGLGQDFRM--DPAKRKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLASNPPLYGAWVVSSILKDPQ---LTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMTGLTREQVELLRSEHIYMTLNG--------RAAVSLNSTNVEYVSQAIHNVTK.. 390
65 -58.3003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  16  1.SSWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDNGKPYKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVQGINVCLCQSYAKNMGLYGERVGAFTVVKRVESQLKILIRPLYSNPPLNGARIAATILTSPD---LRKQWLQEVKGMADRIISMRTQLVNLKKEGSSHNWQHITDQIGMTGLKPEQVERLTKESVYMTKDGRISGVTSGNVGYLA--HAIHQVTK......... 401
66 -58.2004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  17  17..SLFSAVELAPRDPILGLNEAFNA--DTRPTKVNLGVGVYTNEDGKIPLLRAVRVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKSNPPTHGGAIVAAVLASPE---LRASWVQELGEMRDRIRAMRNGLVRLKAAGIERDFSFINAQRGMSGLTSAQVDRLREEGIYAVSTG--------RICVALNTRNLDVVANAIAAVLK.. 414
67 -58.0002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  16  1...MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYNDETGKTPVLTSVKLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSSPPAHGASVVATILSNDA---LRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGMGGLTKEQVLRLREFGVYAVASGRLNVAG-------MTPDNLAPLCEAIVAVL... 396
68 -57.7004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  12  7EAQTQGPGSMGKPDPILGLGQDFRMDPAK--RKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLANNPPLYGAWVVSSILKDPQ---LTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMTGLTREQVELLREYHIYMTLNGRAAVSG-------LNSTNVEYVSQAIHNVTK.. 403
69 -57.0003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  14  1..........MQPVLVFKLTADFREDPDPGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR-GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMESNPPAQGARIVASTLSNPE---LFEEWTGNVKTMADRILTMRSELRRLEALKTPGTWNHITDQIGMFS-NPKQVEYLVEKHIYLLPSGRINVSGTKNLDYVATVTKIAENLYFQSDYKDD. 413
70 -56.3001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  1...MFENITAAPADPILGLADLFRADERP--GKINLGIGLYYDETGKIPVLTSVKKAEQTTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDA---LRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.......... 396
71 -55.0001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  17  1...MFENITAAPADPILGLADLFRADERP--GKINLGIGVYDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQNYSNPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFIIKMFSFSGLTKEQVLRLREEGVYAVASG--------LVNVAGTPDNMAPLCEAIVAVL... 396
72 -54.0003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  20  15......................TMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQREAFGYQPDG--SLLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT----GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVAASVCITITAPSKAWNIAGLKCAQIIFSPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTD---FLNQEVAYLKNNHDFLLHEIPK-GAKITPMQATYLMWIDFRDTTIEGSPSEFFIEKAKVAMNDGAWFGGTGFCRLNFATSREVLEEAIDRMAKAVSH. 375
73 -53.5004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  18  4..GTFENITAAPADPILGLADLFRADERPGK--VDLGIGYKDETGKTPVMTSVKKAENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSSPPAHGASVVATILSNDA---LRAIWEQELTDMRQRIQRLRQLFVTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREEGVYAVASG--------RVNVAMTPDNMAPLCEAIVAVL... 400
74 -53.4002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  27  5.KYLAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPEL-AVLGEIAKEVLEKEPKMYTPANGIPELREELAAFLKKYDHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG---MRVDLLEEKIKELKAKLIYTIPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALEGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKRGYFEKYHLEGALLGYKEKRDIMLKALEN-NAEFTKPIAGMFVMFFLPEGADGISFANELMEREGVVVVPGKPFSGKNAIRLNFSPSKEEIPIGIKKLAKLYKE. 403
75 -52.9001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  19  1...MFENITTAPADPILGLADLLRADERP--GKIDLGMGTGKTPVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQNYSSPPAHGASVVATILGNDAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFTIKQNGMGGLTKEQVLRLREFGVYAVASG--------RLNVAMTPDNLAPLCEAIVAVL... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.