current user: public

If you have questions about the server, please let us know.

Query: 1bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE), from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MSSWDVSMSNHAGLVFNPIRTVSDNAKPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIKTDVEFFEKLLEEENVQVLPGTIFHAPGFTRLTTTRPVEVYREAVERIKAFCQRHAAVLast
1 -116.0001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model  100  1MSSWDVSMSNHAGLVFNPIRTVSDNAKPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVDPHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIKTDVEFFEKLLEEENVQVLPGTIFHAPGFTRLTTTRPVEVYREAVERIKAFCQRHAAV 416
2 -99.6004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  43  33....RIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPTVDGNLKTPDIVTEAMVDVVRSGKFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQE-ALKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGI----FTSVADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFQDLKSDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCERHKK. 438
3 -96.8004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  23  26......KSSKLENVCYDIRGPVLKEARLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA------QGYCDSKGLYSARKAIMQHYQA------RGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAE----HHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGL-EMLASMRLCANVPAQHAIQTALGGYQSIFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRF-NIHDDQKMVLDFLLQEKVLLVQGTAFNWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL 425
4 -96.5001xi9_A mol:protein length:406 putative transaminase  ali model follow..  28  1..AGSIRASKRALSVEYAIRDVVLPARLEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEG-----HNYYGDSEGLPELRKAIVEREKR------KNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGE-----HISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKL-SEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPW---KNDKEFVLDVLHNAHVLFVHGSGFGGAGHFRAVFLPPIEILEEAMDRFEKFMKERLK. 399
5 -96.4003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  39  16.SMWSVRPSDMAKKTFNPIRAIVDNMKKPNPNKTMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCP-------EAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCK----YEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYH. 420
6 -95.6003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  39  1...WNVRPSDMSNKTFNPIRAIVDNMKKPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCP-------EAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCK----YEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVITVPEVMMLEACSRIQEFCEQH... 401
7 -93.7001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  24  1...MRGLSRRVQAMKPSATVAVNAKAELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG-----KTKYAPPAGIPELREALAEKFRR------ENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGE-----HFSPGRVAP-EHTLTVNGAAKAFAMTGWRIGYACGP------KEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMDTSPIA----PDEVRAAERLL-EAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGR.... 384
8 -92.4001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  22  3......LAARVESVSPSMTLIIDAKAKMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQG-----KTRYGPAAGEPRLREAIAQKLQR------DNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQ----HLSIGAASPYERSVVCSGFAKTYAMTGWRVGFLAGP------VPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAKTG----RSSLDFCSELLDQHQVATVPGAAFGADDCIRLSYATDLDTIKRGMERLEKFLHGI... 387
9 -92.1001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  23  3......LSDRLELVSASEIRKLFDIAA---GMKDVISLGIGEPDFDTPQHIKEYAKEALDKG-----LTHYGPNIGLLELREAIAEKLKKQNGIEADPK-----TEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDAR----HYSIASLDGFERTITVNGFSKTFAMTGWRLGFVAAP------SWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSWVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPRIRDTG----LTSKKFSELMLKEARVAVVPGSAFGGEGYVRISYATAYEKLEEAMDRMERVLKERKLV 389
10 -92.0001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  25  1MGSDKIVSRRISEIPISKTMELDAKAKLIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKG-----EVKYTDPRGIYELREGIAKRIGE------RYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDE-----FTSILDVSEGDRIVYINGFSKSHSMTGWRVGYLISS------EKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS---YMVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVR-------GDDVKFCERLLEEKKVALVPGSAFLKPGFVRLSFATSIERLTEALDRIEDFLNSR... 383
11 -91.4003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  22  1...MSLKNSSRSAVDPFIVMDVMEAARAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETD-----ALGYTVALGLPALRQRIARLYGEWY------GVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAK-------AVTALELTDECYVINSFSKYFSMTGWRVGWMVVPE------DQVRVVERIAQNMFICAPHASQVAALAALDCDAE-LQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDLT----DDSRAFAAEILEKAGVAVTPGLDFDGAGTLRFSYARATADIEEGLDRLEAFMQARGE. 384
12 -89.5004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  19  3MDLSKRFNKNLNKIEVSMIRQFDQ---SISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDAD-----ESHYTGMAGLLALRQAASAFVKEKYHLTYNPD-----NEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT-RSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGES----HVSIAEYLP-DQTILISGLSKSHAMTGWRLGLIFAP------AVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVAQG---QDSFKFLQDFAKEKAVAFIPGVAFGGEGYLRISYAASMETIKEAMKRLKEFMEQYAD. 393
13 -89.5003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  17  2MSIEAKFKKLGTDNAPGQEVRQSAAGRGAPIEGRPVDFSHGDVDAHTPGAFDLFSAGVQSGG-----VQAYTEYRGDLGIRDLLAPRLAAFTGAPVD-----ARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGAS----YTHLRAEAAVENVVTIMGPSKTESLSGYRLGVAFGS------RAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLA----VAPAEFVKILRLQAGVVVTPGTEFSTADSVRLNFSQDHEAAVAAARRIVTLVERYRA. 407
14 -89.3002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  21  7...MDVFSDRVLLTEESPIRKLVPFAEAKKRGVRIHHLNIGQPDLKTPEVFFERIYEN------KPEVVYYSHSAGIWELREAFASYYKR------RQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGE-----FASALSIES-DKVVVIDSVSKKFSACGARVGCLITRN------EELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPV------EDAEEFARWMLTDETTMVAPLRGFYGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCS. 398
15 -89.3005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  23  72......LSPRVQSLKPSKTMVITDLAALVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREG-----FTRYTLNAGITELREAICRKLKE------ENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPAT----HTSFASLPDMERTLTVNGFSKAFAMTGWRLGYLAGP------KHIVAACSKLQGQVSSGASSIAQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGSEINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKALEPLRA. 471
16 -88.9003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  18  24VANKYFTSNTAKDVWSLTNEAAAKAANSKNQGRELINLGQGFFSYSPPQFAIKEAQKALD----IPMVNQYSPTRGRPSLINSLIKLYSPIY------NTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSF----TRIATLSPEIQLTLTVGSAGKSFAATGWRIGWVLSLN-----AELLSYAAKAHTRICFASPSPLQEACANSINDALKYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEKGKDFRISHWLINELGVVAIPPTEFYAENLLRFAVCKDDAYLENAVERLKLLKDYL... 447
17 -88.6005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  22  1...MTDRVALRAGVPPFYVMDVWLAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLN-----QLGYSVALGIPELRDAIAADYQRRH------GITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAP-----QTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPT------VLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDFT----SDSLAFCSKLLADTGVAIAPGIDFDGGSFVRISFAGPSGDIEEALRRIGSWLPSQ... 388
18 -88.5002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  24  1.....MLSKRLLNFESFEVMDILALAQLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEG-----KTHYTDSRGILELREKISELYKD------KYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF--------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGK-----CYSAIEFDENEKTILINGFSKLYAMTGWRIGYVISND------EIIEAILKLQQNLFISAPTISQYAALKAFEKETEEINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPNIG-------EDGREFAYKLLKEKFVALTPGIGFGGKNYIRISYANSYENIKEGLERIKEFLNK.... 370
19 -87.6004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  19  5.....LQARRLDGIDYNPWVEFVKLAS----EHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML---NQYTKTFGYPPLTKILASFFGELLGQEIDPL-----RNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQ----HISIASLPGMERTLTIGSAGKTFSATGWKVGWVLGP------DHIMKHLRTVHQNSVFHCPTQSQAAVAESFEQPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDFKRKDEPYDRRFVKWMIKNKGLVAIPVSIFYFDHYIRFCFVKDEATLQAMDEKLRKWKVELENL 425
20 -86.9001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  19  8......PQSKLPQLGTTIFTQMSALAQ----QHQAINLSQGFPDFDGPRYLQERLAHHVAQG-----ANQYAPMTGVQALREAIAQKTERLYGYQPDAD-----SDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPP-HFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQG----HASVLAHPQLERAVAVSSFGKTYHMTGWKVGYCVAP------APISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSAVST---LDDVEFCQWLTQEHGVAAIPLSVFCPHKLIRLCFAKKESTLLAAAERLRQL....... 386
21 -86.4001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  19  9MHNKFDLPKRYQGSTKSVWVEYIQLAA----QYKPLNLGQGFPDYHAPKYALNALAAAANSP--DPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPM-----TEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFE----HIRICTLPGMERTITIGSAGKTFSLTGWKIGWAYGP------EALLKNLQMVHQNCVYTCATPIQEAIAVGFESPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSSLDSKDARKDYRFTKWMTKSVGLQGIPPSAFYGEDFVRYCFFKKDENLQKAAEILRKWKGS.... 428
22 -86.2002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  20  3......TVSRLRPYATTVFAEMSALAT----RIGAVNLGQGFPDEDGPPKMLQAAQDAIAGG-----VNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPE-----TEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHAR----HLPLAGFDGMERTITISSAAKMFNCTGWKIGWACGP------AELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPL---GYDDSTEFCAALPEKVGVAAIPMSAFCDPALVRFTFCKRDDTLDEAIRRLSVLAERPAT. 398
23 -85.6002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  17  15.....MISNKLANIPDSYFGKTMGRK-IEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIP----ENQKYGAFHGKEAFKQAIVDFYQRQYNVTLDKE-----DEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAK-----NPSILASENKDVAIEIYSLSKGYNMSGFRVGFAVGN------KDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPPGY-----DSEQFEQFLVQEKSILVAPGKPFGGNRYVRISLALDDQKLDEAAIRLTELAYLYE.. 398
24 -84.9005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  18  2......NAKRIEGLDSNVWVEFTKLAA----DPSVVNLGQGFPDISPPSYVKEELSKAAFI----DNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPN-----EEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHT----HVKIATLPGMERTITIGSAGKTFSVTGWKLGWSIGP------AHLIKHLQTVQQNSFYTCATPLQAALAEAFWDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSLGADDEPYDYKFVKWMTKHKKLTAIPVSAFCFEKLVRFCFIKKDSTLDAAEEIFRAW....... 410
25 -84.8001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  20  3......LHPRTEAAKESIFPRMSGLAQ----RLGAVNLGQGFPSNPPPPFLLEAVRRALG------RQDQYAPPAGLPALREALAEEFA------------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGER-----PRRLREFAP-ERTFTVGSAGKRLEATGYRVGWIVGP------KEFMPRLAGMRQWTSFSAPTPLQAGVAEALKRREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAEL----------PGWDAFRLVEEARVALIPASAFYPKDLFRFAFCKTEEELHLALERLGRVVNSPRE. 373
26 -84.3002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  21  10......RFARIDRLPPYVFNITAELKAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQRE----DTHGYSTSRGIPRLRRAISHWYRDRYDVQIDPE-----SEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWK----APSIMQVPGKDIAVEFFTLSKSYNMAGWRIGFMVGN------PELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPEPYAH--LGSLEFAKKLLQDAKVSVSPGIGFGGDDHVRFALIENRDRLRQAVRGIKAMFRADGLL 401
27 -83.4002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  23  3...........RVPEPSVFLVVDEAKKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDP----TTYGYCLKSCTLPFLEEAARWYEGRYGVGLDPR-----REALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALP----GAKERVVELFSLSKSYNLAGFRLGFALGS------EEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGV--LSLLPPRATMYLWGRLPEGV-----DDLEFGLRLV-ERGVALAPGRGFGGKGFVRIALVRPLEELLEAAKRIREALD..... 376
28 -82.8003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  19  39......RNENFGKLRAGEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLATREGYSGYGAEQGQGALREAVASTFYGHAG--------RAADEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCP----KTIYEIPGDEVAIETCSFSKYAGFTGVRLGWTVVPKAYANGEPVHADWNRVMTTCFNGASNIVQAGGLACLQPGLKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFPG------KPSWDVFAEILERCNIVTTPGSGYGGEGFVRASAFGSRENILEAVRRFKEAYGKRNA. 442
29 -82.6003ele_A mol:protein length:398 Amino Transferase  ali model follow..  19  12............GSVRSAIRELFEYGKAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDY-DSVALHGYTSAQGDVETRAAIAEFLNN------THGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTE-HFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFV-------KYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRALYVCAPSLFQKMIVKCQGATG-----DINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKALE------DDSNAFCEKAK-EEDVLIVAADGFGCPGWVRISYCVDREMIKHSMPAFEKIYKKYNK. 398
30 -82.6003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  21  50.RGIKKPFTEVIRANIGDAQAMGQQPTFLRQVMALCTYPLDSPSFPEDAKKR---ARRILQACGGNSLGSYSASQGVNCIREDVAAYITRR-----DGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSV-----RLCPPVSGQAAMDIVVNPPVAGEESFEQFAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE. 489
31 -81.9006DK6 Entity 1(prereleased)  ali follow..  17  3LINENFLKLKAGYLFPEIARRVKAFTGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELGNRSTFKGYGPEQGYDFLRNAIADNDYKAR------GLPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIP----HSIFEIEGRDCAIEFRSFSKNGGFTGVRCAYVVIPKSNGEAQALHPLWSRRHSTKFNGASYIVQKGAEALYTDGKSQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPAGL-----TSWQMFDKMLNEANVVITPGSGFGGEGYFRISAFNSRANVEEVCRRIAAL....... 410
32 -81.6002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  17  26......RNSNMSKLQAGYLFPEIARRRLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGL--------GIGDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDN-----PRSIFEIPGEEVAMETASFSKYAGFTGVRLGWTVIPKKYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPGLEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPN------QSSWDVFAEILEKTHVVTTPGSGFGGEGFVRVSAFGHRENILEACRRFKQLYK..... 426
33 -81.1003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  16  64.......PQSLGQQPVTFFREVLALC----DHPDLLQREEIKTLFSAISRAKQILAMIPGRAT-----GAYSHSQGIHGLRDAIASGIAS------RDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFHSFKKIVR-EDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICAAKAANKAPDAFYALRLLESTGIVVVPGSGFGGTWHFRCTILPQEDKIPAVISRFTVFHEAFMS. 486
34 -80.6004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  17  40......RNVNLEKLKNNYLFPEINRREEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLSTVEGYRGYGLEQGNKTLRKAIAETFYRDL--------HVKSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGS-----PRSIYEIPGREVAIEVSSFSKFAGFTGVRLGWSIIPDELSNGFPIINDFHRIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFKGS------KSWDVFNEILENTHIITVPGSGFGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTK. 444
35 -80.3003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  18  1MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGF---------VDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLP----KSIFEIPDRFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ--LEAIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPTQAN----ISDRDLFDFFLREYHIAITPGIGFGGSGFVRFSSLGKREDILAACERLQMAPALQS.. 394
36 -80.2004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  18  14....HMSSLRPRREDPPVLEEWYRRHL-GPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAV-----VMDDSVSQGGEGVRRAIADRYAG-----------GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADP-------ADGGDTVSYGTLSKTFGLPGLRVGWAVAP------KELLTATFPLRDRTTLFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELERAAAQEVERFCLELLERHRTLLVPGTAFGAPHGARLGFGGPQEDFRAGLDGLSRFLRERAA. 398
37 -80.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  15  2...........MTFEPYPFERLRALLKEITPKKRGLDLGIGEPQFETPKFIQDALKNHTH------SLNIYPKSAFEESLRAAQRGFFKRRF------KIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMLAGNEFKNVLVIHSLSKRSSAPGLRSGFIAGD------SRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRH-AEFFRNIYANNLKLARKIFKNTL-----IYPYSFYVYLPVQ--------NGENFAKTLYQNEGIITLPALYLGGADYVRLALVYDTPLLEKPLEIIETYRENHA.. 376
38 -79.4003jtx_A mol:protein length:396 aminotransferase  ali model follow..  19  2......MNTLLKQLKPYPFARLHEAMQSAPEGMEAVPLHIGEPKHPTPKVITDALTASLHEL------EKYPLTAGLPELRQACANWLKRRY-----DGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRRQKLLMFTSLSKRSNVPGLRSGFVAGD------AELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQH-VIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVPD------GDDLAFARNLWQKAAIQVLPGRFLAGEGYVRIALVADVATCVKAAEDIVSLYR..... 396
39 -78.3003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  20  1.......GMKLPRFGVEEWLNVHESAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGT-----KLNYGWIEGSPAFKKSVSQLYTG-----------VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVP--------SIIEVYDKGIAVNSLSKTYSLPGIRIGWVAAN------HQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAVD-----MPMEDFCLQLLQEHGVLLVPGNRFERDGYVRLGFACEQETLIKGLEKLSQFLRRFDK. 373
40 -77.5003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  14  10LIREKQNELHIKDLGMASIRDLVALVTEKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVA----SIYPNLDGLPELKQEASRFAKLFV------NIDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDSHPGEPLYQPSVANTDNYILALSSSKAFSYAGQRIGVLMISGKEREYPDLEESFGRLRYALSSGATHSAQWGMAAMLKACNDNFRDSVIEYGRKARIMKKMFLDVYDKDGNEPLADGFYFTVGYKGM-----DSSKLIEKFVRYGMCAITLKTTGSRNEAMRICTSLLESQFPDLEKRLQMLNAE.... 436
41 -76.8003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  15  77.......YINTDGIRERLFAFLDPDKDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVAN-------NYPVPDRCLVNTEKIINYFLQEL---SYKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVV--------PYNTMLVYSYSKLFGCTGWRLGVIALNE------KNVFDDNIAHLDKVELRQLHKRYSSVVRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTTDTNTHYYSLIDIYRDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAPGELRVSQANLPTEYALIGKQVLELLKEYYE. 527
42 -71.7001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  1...MRMLSRNATFNSHGQDSSYFLGWQEVHNTNGIIQMGLAENAKNPEAAAFKKNGESIFAEL-----ALFQDYHGLPAFKKAMVDFMAEIR----GNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCTSSNGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPS----FISVMEVLKDQRVHVVYSLSKDLGLPGFRVGAIYSNDDM-----VVAAATKMSSGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKS-GISCLNGNAGLFCWVDMRHLL-NTFEAEMELWKKIVYEVHLNISPGSSCHCPGWFRVCFANPERTLDLAMQRLKAFVGEYYNV 435
43 -70.6002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  12  87................ERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG--------CNYPVPPRMLTVSEQIVRQYIVR--EMAGGAVPPESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVC--------PRNTLLVYSFSKYFGATGWRLGVIAAHKDN------------VFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKSTGDMLFRVADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRRLAD.... 519
44 -69.9001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  18  1.....ILSKLATNEEHGENSPYFDGWKPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFK------AIANFQDYHGLPEFRKAIAKFMEKTR----GGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCESSNNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQ----FVSIAEILDEDLVHIVYSLSKDMGLPGFRVGIIYSFND-----DVVNCARKMSSFGVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEV-VGIKCLKNNAGLFCWMDLRPLL-STFDSEMSLWRVIINDVKLNVSPGSSFECPGWFRVCFANMDDGVDIALARIRRFVGVEK.. 428
45 -69.5006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  14  9VPRGSHMHPQATPAPGAPLLDLTQHEQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA------EEGLQATYEKRFTEAFFQLHRQPT--------ALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPL--YPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYELLENSGVRYLAIEDTGKTWPVQDAKCALITAS------DDIWETVYNLHTSVLNVSPFVLNMLTQYVRDSAADRLASVREVLTRNRECARKTLDGS-ILEYQEPVVKSVAWFRVD-----HPELTATDVHRLLSADGVYVLPGRYFYGDAYVRMALAREPEMFADAMALTRQVLDRHGR. 407
46 -69.1005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  14  8........................KENLTQWAYLALNSELNIADGHARQALSPGQQKIVNEL-----PVLWAESEQRPEAHQAYFTLLGQH-------GYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGA-----DLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLQ----EAGCRWVVIEDTGKLWPTLDLKAGLLVFSE------DIGLPVEKIYSDILGVSPLILALIREFSRDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVE-----------RTGTEVW-EELQRHHVFALPCRQFHGDHMVRIALSRSTEPLEKSVQVLRTVLET.... 375
47 -69.0003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  15  1..GMTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKAADALCNYDGPQGKTALLNALAVLLRETL------GWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFSEARPLW------NPNIILCMSLSK-LGLPGSRCGIIIAND------KTITAIANMNGIISLAPGGMGPAMMCEMIKRNRLSETVIKPFYYQRVQQTIAIIRRYERCLIHKPEGAIFLWLWFK-----DLPITTELLYQRLKARGVLMVPGHYFFTHQCMRMNYVPEPDKIEAGVKILAEEIERAWR. 415
48 -68.3002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  13  88................ERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-------GCNYPVPPRMLNISEKIVRQYIIREMGADAIPS---ESVNLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAIC--------PENTLLVYSFSKYFGATGWRLGVVAAHQ------QNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDHTLKQLIRRRETTLYRELGMPPLRD-ENAVDYYTLIDLQSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRKMAD.... 520
49 -67.5003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  14  88................ERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-------GCNYPVPPRMLNISEKIVRQYIIREMGADAIPS---ESVNLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFAIC--------PANTLLVYSFSKYFGATGWRLGVVAAHK------ENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLVKQLIRRREATLYRELGT-PPQRDENAVDYYTLIDLQSKWAVKQSSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRLRQMADELYA. 524
50 -66.4003if2_A mol:protein length:444 Aminotransferase  ali model follow..  14  1..GMKFSKFGQKFTQPTGISQLMDDLDALKSDQPVNMLGGGNPAKIDAELFLETYKALGNDNDTGKSMANYSNPQGDSAFIDALVGFFNRHY------DWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIY------SDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADA------KVIEAVSAMNAVVNLAPTRFGAAIATPLVANKQLSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKDLPI----STLDLYERLK-AKGTLIVPSEYFFAHECIRMSIAADEQTLIDGIKVIGEVVRELYD. 442
51 -63.0002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  11  3MNPLAQLNEQLQQSNATAFAMLSDLGQSAEAKSTTYNATIGMATNKDGKMFASSLDAMFND-LTPDEIFPYAPPQGIEELRDLWQQKMLRDNPELSIDNM----SRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFTALTNLHSNILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKELEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFIQTLKERYEVTKEVVYADQYH-SHWQAYDFNSGYFMAIKVHDV------DPEALRKHLIDKYSIGVIALNATD----IRIAFSCEKDDIPHVFDSIAKAIDDLR.. 430
52 -60.4003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  13  2..........VKLENSRKPEKISNKNI--PMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIR--GCDLMSYFSDMTEPELEDAIKDLHGVVG------NAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHY-----------TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKD-----KEVAKKMVEYIIVNSIGVSKESQVRTAKILNESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAKEETDLVSELRRHKVMSRAGERCGSKKHVRVSMLSREDVFNVFLERLANMKLIKSI. 389
53 -59.5004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  14  8......IKRATWNNGPDLAFDINNKANEKYGREAVINAALGTLLDDKGKIIALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPE-------GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPRNLFVVVAFSMSKSHTAYGLRSGAAVGI---SSSKEIIEEFEASLAHSARCNWSNGTHAAQNILIE-EQELVDLRNMLKSRADVFVTAAKE-NKLTMIPYFGGFFTFIPT---------DKAFDIVKDLEKENIFTIPSAKGI-----RVAICVGEEKIPKLVQRLAFYTNK.... 412
54 -58.7004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  15  3......MFEHIDAYPGDPILTLNENFQ-KDPRDQKVNLSIGIYDAEGRIPVMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFG------ADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRELARRG--VPTLVANSFSKNFSLYGERVGGLSVVEDAAAAERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGM-FTYTGLTESQVDALREVHGVYILRSG--------RMCVALNDSNVGIVADAIGKVLKSGA.. 402
55 -58.5001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  3........ENITATTADPILGLADLFR-ADERPGKIDLGIGYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRART--AQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFALYNERVGACTLVADSETVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGM-FSFSGLTKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 396
56 -58.0001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  13  3........GNLKPQAPDKILALMGEFR-ADPRQGKIDLGVGVYDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETT-----ATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRI--PEVLIAASCSKNFGIYRERTGCLLALADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGM-FSRLGATPEQVKRIKEEFGIYMVGDS--------RINIALNDNTIPILARAIIEVG...... 393
57 -57.7005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1....SSWWTHVEMGPPDPILGVTEAFK-RDTNSKKMNLGVGAYRDDNGKPVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSG-RFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFI-EQGINVCLCQSYAKNMGLYGERVGAFTMVKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGM-FCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK............ 401
58 -57.7001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  28.....LDGIISEGSPKCECNTCYTGPDCSEKQGCSADVASGDGLFLEEYWKQHKEASAVLSPWHRMSYFFNPVSNFIFELEKTIKELHEVVG------NAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYTPIK-----------YKADEDILLFTMSKFTGHSGSRFGWALIKDE-----SVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPVKCEWEEDKDCYQTFQNGRINTQNGVGFESSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRK. 427
59 -57.6003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  15  4MTSV-AAKHAKGKKLKDVIFVTAGQAQKENGRENVVNGTLGAIHDEEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRPE-------GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVNQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGIDDEEIADEFFEVNKSTSRATWSNICRPAMRTMANIVADPEAERNCYYQLIRDRADIFKQEAAQV-GLPMLPYRGGFFITIPTD--------SANAICEELKKEHIYVIALANGIAACGIPKCQMTGLAEKIYNAMKSLGKL....... 418
60 -56.9003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1....SSWWTHVEMGPPDPILGVTEAFK-RDTNSKKMNLGVGAYRDDNGKPVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSG-RFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDA-WAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGM-FCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK............ 401
61 -56.8003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  3........ENITAAPADPILGLADLFR-ADERPGKINLGQGVYKDETGKTVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTA--QTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGACTLVAADETVDRAFSQMKAAIYANYSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL-------TKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 396
62 -56.7002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  3........ENITTAPADPILGLADLLR-ADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFG------KGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGACTLVAASETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGM-FFFGGLTKEQVLRLREEFGVYAVASGRLNVAG-------MTPDNLAPLCEAIVAVL...... 396
63 -56.7003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  14  3........QKVDAYAGDPILTLMERFKEDPRSIGLYYNEDGIIPQLQAVAEAEARLNAQPHG-----ASLYLPMEGLNCYRHAIAPLLFG------ADHPVLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAG--LPALVSNSFSKIFSLYGERVGGLSVMEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGM-FSYTGLSAAQVDRLREEFGVYLIASG--------RMCVALNTANVQRVAKAFAAVM...... 397
64 -56.5002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  3........ENITTAPADPILGLADLLR-ADERPGKIDLGMGVYDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQ--TPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGACTLVAASETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL-------TKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 396
65 -56.3004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  15  20........SAVELAPRDPILGLNEAFN-ADTRPTKVNLGVGVYTNEDGKIPLLRAVRDAEKARVEAGPRGYLPIDGIAAYDASVQKLLLG------DDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAAAN--LNVFVSSSFSKSFSLYGERVGALSIIDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGM-FSYSGLTSAQVDRLREEFGIYAVSTG--------RICVALNTRNLDVVANAIAAVLK..... 414
66 -56.3004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  13  5......TFENITAAPADPILGLADLFR-ADERPGKINLGIGVKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFG------KGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGACTLVADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL-------TKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 400
67 -55.8004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1..........MAMGKPDPILGLGQDFR-MDPAKRKVNLSIGVYDDADQPFVLECVKQATLGT-----NMDYAPVTGIASFVEEAQKLCFGPTCAALRDG-RIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPRH--VDMVPNLIVAQSFSANFGLYGHRCGALHISASAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGM-MAYTGLTREQVELLRSEYHIYMTLNG--------RAAVSLNSTNVEYVSQAIHNVTK..... 390
68 -55.4001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  3........ENITAAPADPILGLADLFR-ADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQ--TPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGACTLVADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGM-FSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL............. 396
69 -55.1004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  12  10......TQGPGSMGKPDPILGLGQDFR-MDPAKRKVNLSIGVYDDADQPFVLECVKQATLGT-----NMDYAPVTGIASFVEEAQKLCFGPTCAALRDG-RIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPRH--VDMVPNLIVAQSFSKNFGLYGHRCGALHISTASEEAKRLVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGM-MAYTGLTREQVELLRSEYHIYMTLNGRAAVSG-------LNSTNVEYVSQAIHNVTK..... 403
70 -54.1001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  3........ENITAAPADPILGLADLFR-ADERPGKINLGIGVYDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFG------KGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGACTLVADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNG-MFSFSGLTKEQVLRLREEFGVYAVASG--------LVNVAMTPDNMAPLCEAIVAVL...... 396
71 -53.3003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  11  1.............MQPVLVFKLTADFREDPDGVGAYRTDDCHPWVLPVVKKVEQKIANDNSL-----NHEYLPILGLAEFRSCASRLALGDDSPALKEKGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR-GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRY--VSEGFEFFCAQSFSKNFGLYNERVGNLTVVKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGM-FSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGTKNLDYVATVTKIAENLYFQSDYKDDDDK. 416
72 -52.5004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  7........ENITAAPADPILGLADLFR-ADERPGKVDLGIGYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQ--TPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGACTLVADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGM-FSFSGLTKEQVLRLREEFGVYAVASG--------RVNVAMTPDNMAPLCEAIVAVL...... 400
73 -52.2003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  18  10...................LRARNTMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQREA------GYQPDG--SLLSQATAEFYADRY------GYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT----GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQ-----HTVAAGVSDTSVCITITAPSKAWNIAGLKCAQIIFSNP-----SDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKIPGAKITPMQATYLMWIDFR-----DTTIEGSPSEFFIEKAKVAMNDGAWFGGTGFCRLNFATSREVLEEAIDRMAKAVSHHT.. 377
74 -51.9001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  13  3........ENITTAPADPILGLADLLR-ADERPGKIDLGMGVYNDETGKTVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTA--QTPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMH--KELIVASSYSKNFGLYNERVGTCTLVAADETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGM-FFFGGLTKEQVLRLREEFGVYAVASG--------RLNVAMTPDNLAPLCEAIVAVL...... 396
75 -49.6002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  17  1MDYTKYLAGRANWIKGSALADVMKKAELQKKGVKLISLAAGDPDPELPRAVLGEIAKEVLE--KEPKSVMYTPANGIPELREELAAFLKKY------DHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG---MRVDLLEEKIKELKAKLIYTIPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIV----PLKALDNEGRVIVAGTLSKVLG-TGFRIGWIIAEG------EILKKVLMQKQPIDFCAPAISQYIALEYLKREKYHLEGALLGYKEKRDIMLKALENLPNAEFTKPIAGMFVMFFLPEGA-----DGISFANELMEREGVVVVPGKPFSGKNAIRLNFSPSKEEIPIGIKKLAKLYKEKFG. 406

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.