current user: public

If you have questions about the server, please let us know.

Query: 1d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAELast
1 -76.0001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model  100  1MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE 166
2 -72.7002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  80  2.....SAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSDVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE 162
3 -71.3002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  77  2..ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPD. 164
4 -69.5003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  66  2......ESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAV-PEMWSPEMKVAWGQAYDHLVAAIKAEMNLSN 160
5 -69.2003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  67  2.....SSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAV-PEMWSPEMKNAWGEAYDQLVAAIKSEMKPSS 161
6 -68.3003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  65  2.....SSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAV-PEMWSPEMKNAWGVAYDQLVAAIKFEMKPS. 160
7 -66.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  46  2............ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLEVTG-VVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVV-GAKWSEELNSAWTIAYDELAIVIKKEMDDA. 152
8 -63.4004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  22  2......ATLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMEENPETFQIFPWADATAKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHE---PKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE...... 154
9 -62.8002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  18  1.............MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTA---ASSLDESQAATWAKLVDHVYAIIFKAIDDDG 150
10 -61.5002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  20  1..........GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLE---EYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSL-GPDFTPATRTAWSRLYGAVVQAMSRGWDGE. 154
11 -61.1001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  19  1.............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNGRSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLE---EYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSL-GPAFTPATRAAWSQLYGAVVQAMSRGWDGE. 151
12 -61.1001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  42  1...........VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLAN--GVDPTNPKLTGHAEKLFALVRDSAGQLKASGTV----VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAV-GDKWSDELSRAWEVAYDELAAAIKKA..... 143
13 -61.0004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  19  1.............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLE---EYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCL-GPAFTPATRAAWSQLYGAVVQAMSRGWDGE. 151
14 -59.8001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  17  1.XGATQSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQMAGSPAELRTSRQMHAHAIRVSALMTTYIDEMDT----EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEL-GVGFTKQVHDAWAKTFAIVQGVLITKHAS.. 159
15 -59.6004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  19  1.XSRVAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKTSPSAKGKFARLGDVS-AGKDNSKLRGHSITLMYALQNFVDALDDVERLK---CVVEKFAVNHINRQISADEFGEIVGPLRQTLKARM-GNYFDEDTVAAWASLVAVVQAAL........ 152
16 -59.2002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  15  1..........XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKAHPETLTPFKSLGLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLV---VLIQKMAKLHNNRGIRASDLRTAYDILIHYMED---HNHMVGGAKDAWEVFVGFICKTLGDYMKELS 152
17 -58.9001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  19  3...GTLAIQAQGDLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSSQLRSSRQMQAHAIRVSSIMSEYVEELDS----DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAEL-GSDFNEKTRDAWAKAFSVVQAVLLVKHG... 158
18 -58.5004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  19  3.....DAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTRLGDVQ-KGKANSKLRGHAITLTYALNNFVDSLDDPSRLK---CVVEKFAVNHINRKISGDAFGAIVEPMKETLKARM-GNYYSDDVAGAWAALVGVVQAAL........ 150
19 -58.2002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  16  1.............MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKKYPHNLNHFPWFKEIPDDLPENARFKTHGTRILRQVDEGVKALSVDFGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVK---LNEKQVHAYHKFFDRAYDIAFAEMAKM. 150
20 -57.9003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  15  1..........SSGLTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSLNVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLV---VLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCH---VEGSTKNAWEDFIAYICRVQGDFMKER. 151
21 -57.3001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  23  1............SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEKFPDSANFFADFKGKSADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMS---AMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA---PPAGADAAWTKLFGLIIDALKAAGK... 146
22 -56.9001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  23  1...........XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKSADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMS---AMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA---PPAGADAAWTKLFGLIIDALKAAGA... 147
23 -56.9001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  19  2.............LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAKHPEVRPLFD---------MGRQESLEQPKALAMTVLAAAQNIENLPAIL---PAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVL-GDAATDDILDAWGKAYGVIADVFIQVEADLY 141
24 -56.6001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  21  1............GLSAAQRQVVASTWKDIADNGAGVGKECFTKFLSAHHDMAAVFGFSG------ASDPGVADLGAKVLAQIGVAVSHLGDEGKMV---AEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRI-GGKMNAAAKDAWAAAYADISGALISGLQS.. 147
25 -56.6001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  20  1............GLSAAQRQVIAATWKDIADNGAGVGKKCLIKFLSAHPQMAAVFGFSG------ASDPGVAALGAKVLAQIGVAVSHLGDEGKMV---AQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRI-GGKMNAAAKDAWAAAYADISGALISGLQS.. 147
26 -56.4001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  21  1............GLSAAQRQVVASTWKDIADNGAGVGKECLSKFISAHPEMAAVFGFSG------ASDPGVAELGAKVLAQIGVAVSHLGDEGKMV---AEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRI-GGKMNAAAKDAWAAAYGDISGALISGLQS.. 147
27 -56.2003uh6_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSIALMYALQNFIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
28 -56.2002r4x_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGVSITLMYALQNFIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKMNGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
29 -56.1003uhd_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVEKFAVAHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
30 -56.1003uhb_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVEKFAVNHITKKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
31 -56.0003ugz_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
32 -56.0003ugy_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNYIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
33 -56.0003uhc_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQAFIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKINGPIKKVLAS----KNFGDKYANAWAKLVAVVQAAL........ 146
34 -56.0003uhi_A mol:protein length:146 Globin-1  ali model follow..  14  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVERFAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
35 -56.0002auo_A mol:protein length:146 Globin I  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVEKYAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
36 -55.9001x46_A mol:protein length:150 hemoglobin component VII  ali model follow..  24  2........PTWVDMEAGDIALVKSSWAQIHDK----EVDILYNFFKSYPASQAKFSAFAGKDESLKDTAPFALHATRIVSVINEAIALMGVAENRPALKNVLKQQGINHKGRGVTAAHFEEFETALEAFLESH--ASGYNAGTKKAWDSAFNNMYSVVFPEL.... 150
37 -55.9001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  14  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGNVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
38 -55.9002grf_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
39 -55.8002r4z_A mol:protein length:146 Globin-1  ali model follow..  13  2.....SVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDDLV---CVVEKFAVNHITRKISAAEFGKINGPIKKVLA----SKNFGDKYANAWAKLVAVVQAAL........ 146
40 -55.6001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  14  1.........AFVGLSDSEEKLVRDAWAPIHGDLQGTANTVFYNYLKKYPSNQDKFETLKGHPDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQ---KVIADMSGPHVARPITHGSYNDLRGVIYDSMH-------LDSTHGAAWNKMMDNFFYVFYECLDGRC 148
41 -55.6001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  22  7.EMEIERRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHDPLEMERSPQLRKHASRVMGALNTVVENLHDPDKVS---SVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEF-ASDFPPETQRAWAKLRGLIYSHVTAAYKEVG 170
42 -55.3002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  20  1.............MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNDYPEVKPMFNMEKQISGE---------QPKALAMAILMAAKNIENLENMR---SFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLN---PDEATLKAWEVAYGKIAKFYIDIEKKL. 137
43 -54.8003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  22  2.............IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEEPTVSVLFQ------------NPISSQSRKLMQVLGILVQGIDNLEGLI---PTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYL-GQGFTEEAKAAWTKVYGIAAQVMTA...... 132
44 -54.7003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  21  1.............MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDVEPKVRPLFK------------IDIEKQGRKLMDVLNWIVLNLQDIDAAL---DAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMI-GSEWTKQLEQLWTQAYEALAQVMIEE..... 132
45 -54.5005oja_A mol:protein length:163 Myoglobin  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPEILEKFDDLKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRH-PGDFGADAQGAMNKALELFRKDIAAKYKEL. 150
46 -54.5005oj9_A mol:protein length:163 Myoglobin  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGDFGADAQGAMNKALELFRKDIAAKYKEL. 150
47 -54.5001h1x_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVRVLTALGAILKKKGH------HEAELKPLAQDHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
48 -54.3002w6x_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKQGVRVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRH-PGDFGADAQGAMNKALELFRKDIAAKYKEL. 150
49 -54.2001it2_A mol:protein length:146 hemoglobin  ali model follow..  17  4......DQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEII---KSLKDLSQKHKVFKVDSIWFKELSSIFVSTIDGGAEFEKLFSIICILLRSAY............... 146
50 -54.2005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  16  1........GSHMGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHTEDEMKASEDLKKHGNTVLTALGGILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLQSKH-PGDFGADAQGAMNKALELFRNDIAAKYKEL. 153
51 -54.2001myh_A mol:protein length:153 MYOGLOBIN  ali model follow..  16  1............GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDRFKHSEDEMKASEDLKKHGNTVLTALGGILKKKGH------HEAELTPLAQSHATHKIPVKYLEFISEAIIQVLQSKH-PGDFGADAQGAMSKALELFRNDMAAKYKEL. 149
52 -54.1001co8_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYAEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
53 -54.1002oha_A mol:protein length:154 Myoglobin  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELWRKDIAAKYKEL. 150
54 -54.1001obm_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKQGVTFLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
55 -54.1002ohb_A mol:protein length:154 Myoglobin  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFWSEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
56 -54.1001ch5_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKVKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
57 -54.0001dxc_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKQGVRVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
58 -54.0001v5h_A mol:protein length:193 Cytoglobin  ali model follow..  21  10.EMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVS---SVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEF-ASDFPPETQRAWAKLRGLIYSHVTAAYKEVG 173
59 -54.0001cik_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHATHKAPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
60 -54.0004pqb_A mol:protein length:154 Myoglobin  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDIEIRLFKSHPETLEKHDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGDFGADAQGAMNKALELFRKDIAAKYKEL. 150
61 -54.000101m_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
62 -54.0006bmg_A mol:protein length:154 Myoglobin  ali model follow..  19  1...........MVLSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHSEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PADFGADAQGAMSKALELFRKDIAAKYKEL. 150
63 -53.9005ojc_A mol:protein length:163 Myoglobin  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDTLIRLFKSHPEILEKFDGLKHTEAEMKASEDLKEHGVTLLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKHLEFFSEAIIHVLHSRH-PGDFGADAQGAMNKALELFRTDIAAKYKEL. 150
64 -53.9002e2y_A mol:protein length:154 Myoglobin  ali model follow..  16  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKWDRFKHTEAEMKASEDLKKDGVTILTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
65 -53.9001lhs_A mol:protein length:153 MYOGLOBIN  ali model follow..  17  1............GLSDDEWNHVLGIWAKVEPDLSAHGQEVIIRLFQLHPETQERFAKFKNTIDALKSSEEVKKHGTTVLTALGRILKQKNNHEQE------LKPLAESHAKHKIPVKYLEFICEIIVKVIAEKH-PSDFGADSQAAMKKALELFRNDMASKYKEF. 149
66 -53.9001mnh_A mol:protein length:153 MYOGLOBIN  ali model follow..  16  1............GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHSEDEMKASEDLKKVGNRVLTALGGILKKKGH------HEAELTPLAQSHAKHKIPVKYLEFISEAIIQVLQSKH-PGDFGADAQGAMSKALELFRNDMAAKYKEL. 149
67 -53.9001do1_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
68 -53.9005utb_A mol:protein length:154 Myoglobin  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTALTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFYSEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
69 -53.8001emy_A mol:protein length:153 MYOGLOBIN  ali model follow..  14  1............GLSDGEWELVLKTWGKVEADIPGHGETVFVRLFTGHPETLEKFDKFKHTEGEMKASEDLKKQGVTVLTALGGILKKKGH------HEAEIQPLAQSHATHKIPIKYLEFISDAIIHVLQSKH-PAEFGADAQGAMKKALELFRNDIAAKYKEL. 149
70 -53.8002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  15  2.............LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFD----LSHGSAQVKAHGKKVADGLTLAVGHLDD------LPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHL-PNDFTPAVHASLDKFLSSVSTVLTSKYR... 141
71 -53.8001mcy_A mol:protein length:154 MYOGLOBIN (CARBONMONOXY)  ali model follow..  18  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKQGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGDFGADAQGAMNKALELFRKDIAAKYKEL. 150
72 -53.7004lpi_A mol:protein length:154 Myoglobin  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKYDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGDFGADAQGAMNKALELFRKDIAAKYKEL. 150
73 -53.7001ch1_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPGAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
74 -53.7001fcs_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1...........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKVGVRVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRH-PGNFGADAQGAMNKALELFRKDIAAKYKEL. 150
75 -53.7001spg_A mol:protein length:144 HEMOGLOBIN  ali model follow..  16  1...........XSLSATDKARVKALWDKIEGKSAELGAEALGRMLVSFPQTKIYFSEWG--QDLGPQTPQVRNHGAVIMAAVGKAVKSIDN------LVGGLSQLSELHAKLRVDPANFKILAHNIILVISMYF-PGDFTPEVHLSVDKFLACLALALSEKYR... 144

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.