current user: public

If you have questions about the server, please let us know.

Query: 1dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARYPVYALast
1 -123.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model  100  1MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARYPVYA 417
2 -118.0005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  52  1.MAMAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVNLDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTNEHAHPFPHCHVVSSTTHKTLRGPRGGIILTNDE--EIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINNVSLQLHVKEELKAMANQFPVYQ 414
3 -117.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  55  1MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDE--EIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNALEQQVLNEVTKLIELFPFYG 420
4 -117.0005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  72  5...ANISISEFDPELAQAIASEDERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEFVDVIEQMAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQYGLNETGEIDYEEVERLALEHKPRMIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKAN-EEIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVVSGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGDEKVIADVKAKVEAVCAKFPVYA 418
5 -116.0003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  55  1..SNAMSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFYGVELDGRIDYEKVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRGGIIMTNDE--ELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNNEKLQENIKQELKKLASNFIIYE 413
6 -115.0003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  56  9...FSQSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDE--EIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTHATEQRVRREIFALCERFPIY. 425
7 -115.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  59  7MIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDE--DIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVSGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY. 422
8 -115.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  93  4MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGIDESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGDEELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEATIERVKAKVLDICARFPVYA 420
9 -114.0004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  75  1MFNRDMNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKAN-EAIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDETTITAVKVKVAALCKACPVYG 421
10 -114.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  58  5.....SYITKQDKVIAEAIEREFQRQNSNIELIASENFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTESIAIDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYNFVEYGVDDTERINYDEVRKLALEHKPKLIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYKK---DIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVKGSILTGKEAEETLDSVGITCNKNTIPFDQEKPFVTSGIRLGTPAATTRGFDEKAFEEVAKIISLALKNSKDEEKLQQAKERVAKLTAEYPLYQ 415
11 -113.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  64  9....QSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKA---EYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR 418
12 -113.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  52  16...MSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVDATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQ---QYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKAGGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALATGSSVD-VSALKDRATRLARAFPLYD 431
13 -113.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  59  2.....VSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDP--ELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPS----EALREEVRRLALAHPMP. 407
14 -113.0001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  59  2.....KYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQE---QFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGSEQALEEARQRVAALTDPTSRSA 411
15 -110.0001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  46  15..MLSQPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEMLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVYELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYKIVTGGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-KSALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELTLQIQSVATLREEVENFASNFSLPG 474
16 -109.0005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  46  23..TGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGD-RSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSLANLRQRVEQFARAFPMPG 479
17 -109.0006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  46  11..MLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMISATSIFFNSMPYKVNDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-RSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSVQALREEVESFASLFPLPG 469
18 -109.0001bj4_A mol:protein length:470 PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)  ali model follow..  46  11..MLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMISATSIFFESMPYKVNDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-RSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSVQALREEVESFASLFPLPG 469
19 -109.0005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  46  14...VEGHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTSAVSTYFETMPYRVDETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGYYDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYKLVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGD-RSALVPGGVRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKSDEITQLKNEISAWAGEFPLS. 469
20 -105.0004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  38  1.MFNNEPLEQIDKELHDILADEEKRQRETINLIASENLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDFIDKIEELCQKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSFESKLYKCNSQGYVDLDAVREMALSFKPKVIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACNILNNPFLHADVVTTTTHKILRGPRSALIFFNKKRPGIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQIDLVTNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIP-SDVDCVSPSGVRIGTPAMTTRGAKEKDMEFIADVLARAIKITVDLQELQQLKQEVVTWAGALPFP. 442
21 -105.0004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  40  34..FNNDPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDLFESNSEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILRGPRSALIFFNKKNPGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLVTNGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSD-VDCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILLTDENPKIDELKKEVVQWAKNLPF.. 473
22 -105.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  46  28..TGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKGPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGD-RSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSLANLRQRVEQFARAFPMPG 484
23 -104.0006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  47  5...LDYGLSEADPDVHAIINKEKDRQFRSLELIASENFTSKAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELEILCQQRALAAFDKWGVNVQPLSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMTAKRRVSGTSIYFESESTGVIDYDMLEKTAALFRPKLIIAGASAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAASVLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDAVDLESAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLVSGGSDNHLVLVDLRPSGIDGARVEKILDMASITLNKNSVPGD-KSALVPGGIRIGSPAMTTRGLGEKEFELIADLIHEGVRISLEGDKVSNLRRKVEALATQYPIPG 454
24 -102.0001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  47  21...LAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEHIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMAYKVNDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRGVYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-KSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQQRAVRALRQEVESFAALFPLPG 479
25 -102.0004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  35  1.....MEYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLEGAEYLMGSTHKTFFGPQGGVILTTK---ENADKIDSHVFPGVVSNHHLHHKAGLAIALAE-MLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIIDIEFSASELAKMYEEANIILNKNLLPWDDNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEK---PEKVREDVKEFAKEYSTIH 414
26 -21.0002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  13  54........................................................................PIHDFIHNQLPKFLGCDVARV---GAREAKFAVMHSLAKKDAWVV---MDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRLITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE----GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKREEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEV-GGRFFLYRELKSRKIHGIKPGLT--------------RYFKLSTYGLSDEEVDYVLNAFKEIIEK......................... 369
27 -19.5003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  18  50.........................ANNYLGLADHPALIKTAQTVV------EQYGFGMASVRFICGTQ---TIHKELEKDISEFLGTDDTIL---SCFDANGGLFETLLGPEDAIIS---DELNHASIIDGIRLCKAQRYRYKNN-------AMGDLEAKLKEARFKLIATDGSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENEYCGVADRVDILTGTLGKALGGASGGYTSGHK---EIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHP---IIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMG---KARIRVQMSA----VHTQQQLDRAIEAFGQVGKK......................... 395
28 -19.2001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  15  46.........................SNDYLGLSHHPQIIRAWQQGA------EQFGIGSGGSGHVSGYS---VVHQALEEELAEWLGYSRALL---SGFAANQAVIAAMMAKEDRIAADRLS---HASLLEAASLSPSQLRRFAHN-------DVTHLARLLASPCPGQMVVTEGVFSMD-PLAEIQQVTQQHNGWLMVDDAHGTGVIGRGSCWLQKVKPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLI--YSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSA---IQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAG---TARLRLTLTA----AHEMQDIDRLLEVLHGN............................ 383
29 -19.1002hzp_A mol:protein length:501 Kynureninase  ali model follow..  11  61.....LHLDEEDKDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESI-VGLMKDIVGANEKEIALMNALTVNLHLLMLSFPKRYKILLEAKAPSDHYAIESQLQLHGLNIEESMRMIETLRIEDILEVIEKEGD-SIAVILFSGVHFYQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD----GVDFACWCSYKYLNAGAGAGAFIHEKHAHTIKQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKR----------NPNGIRVAPVPLYN---SFHDVYKFTNLLTSILDSAETKN.................... 495
30 -19.1005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  11  38...............YKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRL--DEVTCPPIKD-FLEDIAKFLNMDCARP-THGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEE--EYPTYKINLEGYKEVIDNKNVGLILLTDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE----KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEK----LGCTSRGLPIVTLMASFPHVVE---VKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPV----DEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKEI---KMSVYGLEWEQVEYVVNAIKEIVE.......................... 408
31 -19.1002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  16  10................................LRSDTVTKP------TEEMRKAMAQAEVGDDVYGEDPTINELE----RLAAETFGKEAA-LFVPSGTMGNQVSIMAHTQRGDEVIL---EADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPPRTSLIAIENTRVVPLENIKEICTIAKEHGINVHIDGARIFNASIA-PVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMR---QAGVLAAAGIIALTKM-----DRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLAN----------AVSDTEIRL----VTHKDVSRNDIEEALNIFEKLFRK......................... 347
32 -18.9001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  13  47...........ELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLHPYQDPRTAQGALRLMWEL-GEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHED--VVLVPDSAHGSNPATASMAGYQVREIP--SGPEGEVDLEALKRELGPHVAALMLTNPNTLLFERRILEISRLCKEAGVQLYYDGANLNAIMG---WARPGDGFDVVHLNLHKTF-GPGSGPVGVKAHGFYLDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEF---VAQPPEGFRALDLAKGLLELGFH---PPTVYFPLIVKEALMVEPTETEA----KETLEAFAEAMGALLKKPKEWLENAPYSTPVRRL........ 457
33 -18.8001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  12  1MTTRNDCLALDAQDSLAPLRQQFALPEGVIYL-NSLGARPVAALARAQAVIAEEWGNGLIR--SWNSAGWRDLSER-LGNRLATLIGARDGEVVVTDTTSINLFKVLSAAPERRVIVTETSN------FPTDLYIAEGLADMLQQGYTLRLVDSPEELPQAIDQ-DTAVVMLTHVNYKYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ----GADYAIGCTYKYL-GPGSAFVWVSPQLCDLVPEPSNGIARYLCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRELTLVTPREHAKRGSHVSFEHP-EGYAVIQALIDRGVIGDYR----------EPRIMRFGFTPLYT---TFTEVWDAVQILGEILDRKTWAQAQFQVRHSVT.......... 416
34 -18.7002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  13  46.........................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN-------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNN---EVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTIRSE----SQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY......................... 383
35 -18.7001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  16  52.........................ANNYLGLANHPDLIAAAKAGM------DSHGFGMASVRFICGTQ---DSHKELEQKLAAFLGMEDAIL---SCFDANGGLFETLLGAEDAIIS---DALNHASIIDGVRLCKAKRYRYANN-------DMQELEARLKEAREHVLIATDGVFSMD-NLKGVCDLADKYDALVMVDDSHAVGFVGENEYCDVMGRVDIITGTLGKALGGASGGYTAARK---EVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGADHA---IIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKG---QARIRTQMSA----AHTPEQITRAVEAFTRIGKQ......................... 396
36 -18.5004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  13  59LPSQGLSSSAVLEKLKEYSSMDAFWQEGRATVYSGEEKLTELLVKAYGDFAWSNPLH-------PDIFPGLRKIEAEIVRIACSLFNGDSCGCVTSGGTESILMACKAYFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVP--LTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDVPEVAKLAVKYKIPLHVDAC-LGGFLI--PFDFRVKGVTSISADTHKYGYAPKGSLVLYSDKKYRNYQFFVDTDWQGIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIGIFVFGNP---QLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP---------PSIHF---CITLLHARKRVAIQFLKDIRESVTQMKNPKAKTTGMGAIYGMAQTTV... 476
37 -18.4003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  13  60.........................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN-------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNN---EVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTIRSE----SQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY......................... 397
38 -18.4003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  12  75LPRAGLPRAEILAEIAAMGAAESPAWRD---VYHGDEHHIAFLNEVYALQSQSNPLH-------PDLWPSTAKFEAEVVAMTAHMLGGTVCGTVTSGGTESLLLAMKTRATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTP--LDADYRADVAAMREAITPNTVVVASAPGYPHGVVDPIPEIAALAAEHGIGCHVDAC-LGGFIL--PFDFRLEGVTSVSADTHKYGYGAKGSVILYRRPDLLHYQYFIAADWPGFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAISLKILGDP----LWVIAVASDELNIYQVMEEMAGRGWRLNGLHRP---------PAFHV---ALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKATGMAPVYGMAAAAP... 494
39 -18.3001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  13  98..AVNNYEDSILPPFFKSLKEYVSRYLIQFDC-PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLI-AEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVL---FDRNNHKSYNSALAMAGGRPVYLQTNRNPYGFIDSDFDEKKIRELAAKAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRN--DPGIIVVQSVHKQQAGSQTSQIHKKDSHIK-HKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAGNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGIIPEKSDLNS--------------ILFLMTPAETPAKMNNLITQLLQLQRLIEEDAPLKQVLPSIYA......... 581
40 -18.3001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  15  1..MAKRIVEPFRIKMVEKIRVPSREERNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLK----DKAKELFNYDYI-IPAHQGRGAENILFPVLLKYKQKEGPVFISNFHFDTTAAHVELNGCKAINIVTE-DWKGDFDIKKLKENIAQHGADNIVAAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQ-YPTGGHAVFVDCKKLVPQ-AVINALYLESGVRAVEIGSFLLGRDPATGE-MRLTIAR-----YTNDHMDYIADALIGLKEKFATLKGLEFEYEPLRHFTARLPI.. 466
41 -18.2002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  15  130..AMTRYRQQLLPPLFSALMKYSDIHEYSWAA-PGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLD-SEKYAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---VDRNCHKSIEQGLMLTGAKPVYMVPSRNRYGEMQPETLQKKISESKPSYCVVTNCTY---YNAKEAQDLLEKTSDRLHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGAIFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR................................................................................................................. 463
42 -18.2003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  16  50.........................SNSYLGLTTDTRIIKAAQDAL------EKYGTGCAGSRFLNGTL---DIHVELEEKLSAYVGKEAAIL---TGFQSNLGPLSCLMGRNDYILL---DERDHASIIDGSRLSFSKVIKYGHN-------NMEDLRAKLSRLPEKLICTDGSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKSHFGLNDDVDLIMGTFSKSL-ASLGGFVAGDA---DVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDLGATESP---ILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAE---ESLIRFSLMA----THTYDQIDEAIEKMVKVFKQ......................... 391
43 -18.1004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  14  52.........................TSDYLNLSSAHNLKHAIVNGF------DKYGFGSKGSNIVCGYT---DETQQFEHEFAKFINYPRAIF---SGFMANLAIYSTLFSKHDSIFADKYI---HASIIDGIKLSQAKLRRYKHQ-------QLSQLQDIYDGKS---FITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLAINSFRISYKNCLICVFPLGKAF-GGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV----NDNRARLQQNITFFNELCDAKDLELVSKDL--SPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKD---QAILRFSLHSN-----TFDQIQQALEIISKEVKY......................... 387
44 -18.1005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  18  48.........................SNDYLGLAAHPQLIAAIAEGA------QRYGAGSGGSHLLGGHS---RAHAQLEDDLAEFVGGFVENARALTGYMANLATLTALAGRGTTLFS---DALNHASLIDGARLSRADVQIYPHC-------DTDALSAMLEASDADKVIVSDTVFSMD-PLPRLLELAEQHGAWLIVDDAHGFGVLGPQAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYI--FTTASVPAAAHAVSASLRIIGGEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTA---VQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTG---TSRLRISLSA----AHSQADLDRLEAGLQQLGAK......................... 394
45 -18.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  16  51.........................TYNYMGMTFDPDVIAAGKQAL------DEFGSGTTGSRVLNGTY---QGHKACEDALKEFYGTEHAIV---TGYQANLGMISTLAGKGDYIIL---DADSHASIYDGCWLGDAEIVRFRHN-------SVEDLDKRLGRLPAKLVVLEGSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHEEAGVEADVDFVVGTFSKSV-GTVGGFCVSNH---PKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHA-GDKRAHLWKNSRRLHQGLRDMGYKL-GTETAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAG---MFLLRCSLCAE-----SDEQVEQILGMFESAGRA......................... 394
46 -18.0003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  4....CEARRAHEHLIRLLLEQGKCPEDG------DESTLELFLHELAVMDSNNFLGNCGVGER--AGSSLLNKITNSLVLKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVINVLEGDELRTDLKAVEAKIQELGPECLHSTTACFA---RLEELAVICANYDIPHVVNNAY--GLQSSKCMHLIVGRIDAFVQSLDKNFMVPVGGAIIAGFNEPFI-QDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNA----AAAIGMKMQDVDLFIKRLDKCLNIVRKEQ.................... 447
47 -18.0005i90_A mol:protein length:427 PvdN  ali model follow..  14  29....AEGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRN-PGEAVDWHREEIWKYEDEARAWAGRYFAVQPGQVALTGSTTDGLAAIYG-VQPGKEILTSSHEHYSTYTLEYRHKRMGTQVREFPLFKDPHRVSADEILSSIAAQIRPQTRVLGMTWVQSGLPIREIGKLVRELNQIYVVDGVHGFGVEDVSFAD----DCDYFIAGTHKWLFGPRGGVIIARSEQLQ-SRADNFGTLMTPGGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHKVRLVTTSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVD---------VGPVVRLAPSLLND----EAEIDRVLEILAPQL........................... 426
48 -18.0003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  14  5MQEKGVSEKEILEELKKYRSLDLKYEDGNI------GSMCSNVLPITRKIVDIFLETNLGDPGLFKGTK---LLEEKAVALLGSLLNNKDAGHIVSGGTEANLMALRCIKNSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAP--IKEDYTIDEKFVKDAVEDYDVDGIIAGTTELGTIDNIEELSKIAKENNIYIHVDAA-FGGLVIPFLDDKYKLGVDSITIDPHKMGHCPIPGGILFKDIGYK-APYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPI-----LNIVAIEDEDYKEVCKKLRDRGIYVSVCN---------CVKALRIVVMPHIKREHIDNFIEILNSIKRD............................. 397
49 -18.0002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  52IPENGIDDEKIKLFLKFLSMMDTDREARTYSKIHEELSSGFCHGIGRSGNLV-------DPQPKASGASIMYALTNKILESFFKQLGLHAIATPISTGMSISLCLSAARKKYGSNVVIYPYA--SHKSPIKAVSFVGMNMRLVEVLDGDRVYVPVEDIENAIKKEIELCVLSTLTFFPP--DIVEIAKICENYDIPHIINGAY--AIQNNYYLEK-KYRVDAVVSSSDKNLLTPIGGLVYSTD------AEFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDY---IVMNAAIGVRTEDIVNSVSKLEKIL........................... 449
50 -17.9005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  18  46.........................SNDYLGLAAHPKLVAAFAEGA------QRYGSGSGGSHLLGGHSRAAKLEDELAGFAGGFSDAPRALY---TGYMANLAAVTALAGKDATIFS---DALNHASLIDGTRLSRATVQVYPHA-------DTATLGALLEACQTKLIVTDTSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYI--FTTAAPPAVAHAVSASLKVIAGDEGDARRAHLAALIERTRALLRRTRWQPVDSHTA---VQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAG---TSRLRISLSA----AHSFDDLARLETALLRASEE......................... 392
51 -17.9005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  12  71LPRAGLPRAEILAEIAAMGAAESPAWRDG--VYHGDEHHIAFLNEVYALQSQSNPLH-------PDLWPSTAKFEAEVVAMTAHMLGGTVCGTVTSGGTESLLLAMKTRATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTP--LDADYRADVAAMREAITPNTVVVASAPGFPHGVVDPIPEIAALAAEHGIGCHVDAC-LGGFIL--PFDFRLEGVTSVSADTHKYGYGAKGSVILYRRPDLLHYQYFIAADWPGFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAISLKILGDP----LWVIAVASDELNIYQVMEEMAGRGWRLNGLHRP---------PAFHV---ALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKATGMAPVYGMAAAAP... 490
52 -17.7001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  15  17....................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAA----RLIGELLERPDADV-ISGGTQTNLIACSLALRPWEAVIA---TQLGHISTHETGAIEATGHKVVTAP-CPDGKLRVADIESALHENIPKLVYISNTTQYTKQELEDISASCKEHGLYLFLDGARLASALSS-TLADIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIK------QRGALMAKGWLLGIQFEVLMKDNFFELGAHSNKMAAILKAGLEACGIRLAWPSASN---QLFPILENTMIAELNNDFDMYTVEPLKDG----------TCIMRL----CTSWATEEKECHRFVEVLKRLVASTA....................... 359
53 -17.7003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  18  4................................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTHNGKVYLKEAWEFTRERNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMT------GGGMRQSGILAAAGIYALKNNVARLQED--DNAAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSREQLAEVAAHWRAFLAR......................... 333
54 -17.7005xx1_A mol:protein length:756 Arginine decarboxylase  ali model follow..  15  131..AMTRYRQQLLPPLFNALMKYSDIHEYSWAA-PGHQGGVGFTKTPSGRFYHDYYGENLFRSDMGIERTTLGSLLD-SEKNAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---LDRNCHKSIEQGLILTGAKPVYMVPSRNRYGIIQPETLQKKISASKPSYSVVTNCTY---YNAKEAQDLLAKTSDRIHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGAVFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR................................................................................................................. 464
55 -17.6002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  15  71.........................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN-------SVEDLDKRLGRLPAKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSKSV-GTVGGFVVSNH---PKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRL-GTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICA----EHTPAQIQTVLGMFQAAGRA......................... 414
56 -17.6001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  15  34...........................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTAAHGIKVFYDATRCVENAYAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIV-EPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVET--TGEHHRPKLETVRLTIPR-----YTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPLRFFTARFYI.. 456
57 -17.5002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  21..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGSLISFSDKAKKKMYSRKTKPFSFYLDTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLVTTVAVPAGYDWRDIVSYVMD-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALVA......................... 386
58 -17.5003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  13  22..........................PTRLLLGPGPSNLAPRVLAAGSLRMIGHMQ------------KEMLQIMEEIKQGIQYVFQTRNPLTLVVSGHCAMETALFNLLEPGDSFLTGT---NGIWGMRAAEIADRIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLG---GVPIYMDQQGIDIMYSSSQKVLNAPPGSLISFNDKAKYKVYSRKTKPVSFYTDTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLITTVTVPAGYNWRDIVSYVLD-----HFSIEISGGLGPTEERVLRIGLLGYN---ATTENVDRVAEALREALQH......................... 387
59 -17.5005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  13  26..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGSLISFSDKAKKKMYSRKTKPFSFYLDTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLVTTVAVPAGYDWRDIVSYVID-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH......................... 391
60 -17.4004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  14  23..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVAFLG---GTPLYMDRQGIDILYSGSQKALNAPPGSLISFSDKAKKKMYSRKTKPFSFYLDTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLVTTVAVPAGYDWRDIVSYVID-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH......................... 388
61 -17.4004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  21..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGHMS------------KEMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGSLISFSDKAKKKMYSRKTKPFSFYLDTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLVTTVAVPAGYDWRDIVSYVMD-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH......................... 386
62 -17.4004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  15  87.........................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN-------SVEDLDKRLGRLPAKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSASV-GTVGGFVVSNH---PKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRL-GTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICA----EHTPAQIQTVLGMFQAAGRA......................... 430
63 -17.3001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  13  4...............ITPSLHQFPGLANKTYF--NFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTDIVLWGLDWHQGDEILLTDCEHPGIIA-QAIAARFGITYRFFPVAATLNQGDAAAVLANHLGP-KTRLVILSHLLWNQVLPLAEIMAVCRRHQVRVLVDGAQSAGSLPLDFSR----EVDYYAFTGHKWFAGPAGGGLYIHGDCLGEINGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAERYQAICQRSEFLWRGLNQPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYL---------RTIADPDCIRACCHYITD----EEEINHLLARLADF............................ 388
64 -17.3003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  11  1.................MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFD------------PAFTGIMNETMEMLRELFQTKNRWAYPITSRAGIEAVLASVIEPEDDVLIPI---YGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMGETSTGRIHPLKAIGEACRTEDALFIVDAVATIG---GCEVKVDEWKIDAAIGGTQKCLSVPSGAPITYNERVADVIAARKKVER-LNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDSCKMPVVTCVEIPGGIDGESVRDMLLA-----QFGIEIASSFGPLAGKIWRIGMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYENAGRQAAV.. 416
65 -17.3003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  13  1MTKITLSDLPLREELRGEHAYGAPQLNVDIRLNTNEN-PSEALVADLVATVDNRYPERDA-----------VELRDELAAYITKQTGVAVTRDNLWAANGSNEILLQAFGGPGRTALGFQPSYSMHPILAKGTHT-----EFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNP--TSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTVVSRTMSKAFAGGRLGYFVANPAFIDAVMLVRLPY--------HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNF-----VFFGDFSDQHAAWQAFLDRGVLIRDVGIAGHLR-------TTIGVPE---------ENDAFLDAAAEIIKLNLSAWSHPQFEK............. 376
66 -17.3002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  13  17..........................PEKIMMGPGPSNCSKRVLTAMTNTVLSNFH------------AELFRTMDEVKDGLRYIFQTENRATMCVSAHAGMEAMLSNLLEEGDRVLIAV---NGIWAERAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQPKCLFLGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLC---GVPFYMDKWEIDAVYTGAQKVLGAPPGTPISISPKALDVIRNRRTKSKVFYWDTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHRLVTGIMIPKGVDWWKVSQYANNFSLEVQ------GGLGPTFGKAWRVGIMGECS---TVQKIQFYLYGFKESLKA......................... 382
67 -17.2002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  13  18..........................PNKLLMGPGPSNAPQRVLDAMSRPILGHLH------------PETLKIMDDIKEGVRYLFQTNNIATFCLSGHGGMEATLCNLLEDGDVILIGH---TGHWGDRSADMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLG---GAPMFMDRWEIDAMYTGSQKVLGAPPGTPVSFSHRAVERYKRRNTKVKVYYWDTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADKDRLSTVTTIKVPQGVDWLKAAQYAKTYLVEIS------GGLGPTAGQVFRIGLMGQN---ATTERVDRVLQVFQEAVAA......................... 382
68 -17.2004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  17  4................................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMT------GGGMRQSGILAAAGMYALKNNVARLQED--DNTAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSRAQLAEVAAHWRAFLAR......................... 333
69 -17.2003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  12  1...............MDITQFSQLNPPSRLLMGPGPINADPRVLRAMSSQLIGQYD------------PAMTHYMNEVMALYRGVFRTENRWTMLVTSRAGIEAILVSAIRPGDKVLVPV---FGRFGHLLCEIARRCRAEVHTIEVPWGEVFTPDQVEDAVKRIRPRLLLTGDTSTTMLQPLAELGEICRRYDALFYTDATASLG---GNPLETDVWGLDAVSAGMQKCLGGPSGSPITLSARMEEAIRRRKCVEERLNHHTEATTALFGARECARLILQEGLDYGIARHKLHGDALVKGIQAMGLETFGDKHKMNNVLGVVIPQGINGDQARKLMEDFGIEIG------TSFGPLHGKVWRIGMGYNARKDCVMTTLSALEAVLNYLKFPTTQGAAMQAAWDHYRS......... 409
70 -17.2005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  14  23FPERGMPRERLLEELRSMAVREDRKWES--TMYCGDHEHYAFLNEAYGLFSHVNALQ-------RDLCPSMNRMESEIVAMTVALLHGRACGALSLGGTESILNATLAY-ERGIERPRMIWPASAHPAFRKAAHLFGFDVTVAP--IDPVTMQVDADFVRDAVDANTVMLVACNYPYGTIDPIGALSAIAVEKDVWLHVDGC-LGGWML-PAFDFRLPGVTSISADTHKFGYGPKGSVLAWRDASFRRHQYFLMTDWVGLTGSRSGGLIAATWAALRSLGREGYLARAKAIFETAFDMQAAVRAIELRVLGKP----TFCFAFTSDAFDIYHVNDFMRQRGWRFNGLQHP---------DALHM-TGPQTQPGVAERFRQDLGEAVEHARHRAHARPQSSGVYGGDAAG........ 448
71 -17.2003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  32MPENSIPKEAAYQIINDELMLDGNPRLNLA--SFVTTWMEPECDKLIMSSINKNYVD-------MDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGSSEAIMLAGLAFKRKWQNIVTGANVQVCWEKFARYFEVELKEVKLS-EGYYVMDPQQAVDMVDENTICVAILGSTLNGEFEDVKLLNDLLVEKNKETGWDT-HVDAASGGFIAP--LPLVKSINVSGHKYGLVYAGGWVIWRNKEDLPEELIFHINYLGLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSLKSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITV---LRVVIREDFSRTLAERLVIDIEKVMRELDELPSRVIH................... 453
72 -17.2002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  14  2.............................LLLTPGPTPIPERVQKALLRPMRGHLD------------PEVLRVNRAIQERLAALFDPGLVAALAGSGSLGMEAGLANL--DRGPVLVLV---NGAFSQRVAEMAALHGLDPEVLDFPPGEPVDPEAVARALKRRRYRMVALGETSTGVLNPAEAIGALAKEAGALFFLDAVTTLG---MLPFSMRAMGVDYAFTGSQKCLSAPPGAPIAASLEARKAFTGKRGWYLDGYHHTTPVLLHYALLEALDLVLEEGVAARERRAREVYAWVLEELKARGFRPYPKASPLPTVLVVRPPEGVDADRLVRALYAEGVAV------AGGIGPTRGQVLRLGLMGEGA---RREAYQAFLKALDRALAL......................... 352
73 -17.1005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  10  7....................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS----EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVIC---SETAHVETDECGAPEFFS-SKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLS--APWVGLLEDGAWLRHGNHANHC---AQLLALLVSDLPGVELMFPVEANGVFLQM------PEHAIEALRAKGWRFYTFI---------GSGGARF----MCSWDTEEERVRELAADIRSIITA......................... 346
74 -17.1001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  14  3..........................RNYLLLTPGPLTTSRTVKEAMLFDSCTWDD------------DYNIGVVEQIRQQLTALATASESVLLQGSGSYAVEAVLGSALGPQDKVLIVS---NGAYGARMVEMAGLMGIAHHAYDCGEVARPDVQAIDAILNADPT-AMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFG---GIPMDIAALHIDYLISSANKCIQGVPGAFVIAREQKLAACKGHSRSLSLDLYATSPTHTVLAFAQALKELAKEGGAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITAFYDPQYRFSEFYRRLKEQGFVIY-------PGKVSQSDCFRIG-----NIGVYAADITALLTAIRTAMYWTK....................... 366
75 -17.0005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  10  29LPKYKLAKHALEPREADRLVRDQLLDEGNSRLNLCQTYMEPEAVELMKDTLEKNAID-------KSEYPRTAEIENRCVNIIANLWHASFTGTSTIGSSEACMLAGLAMLDLTAHQPNIVISAGYQVCWEKFCVYWDIDMHVVPMD-DDHMSLNVDHVLDYVDDYTIGIVGIQYDDLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELLNNVISINASGHKYGLVYPGGWVIWRDQQYLPKELVFKVSYLGINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGFSLINDGHELPLICYELTADSDREYDLSDRLLMKGWQVPTYPLPKNMTDRVI---QRIVVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSDPQPK.............. 462

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.