current user: public

If you have questions about the server, please let us know.

Query: 1dlw_A mol:protein length:116 HEMOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTVLast
1 -68.0001dlw_A mol:protein length:116 HEMOGLOBIN  ali model  100  1SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTV 116
2 -65.6003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  35  6TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLG. 120
3 -64.6002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  34  14SIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTS. 128
4 -64.3001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  35  14SIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTS. 128
5 -61.1002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  20  2TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVN. 120
6 -60.6006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  31  2TLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDP. 120
7 -59.7004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  35  9SLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFG. 127
8 -59.4001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  33  3TLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLN. 123
9 -59.1002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  32  2SLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVRNDVLN. 122
10 -58.5001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  39  44SLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLN. 160
11 -58.4004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  17  23TPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMIN. 143
12 -57.1005d1v_A mol:protein length:127 Globin  ali model follow..  23  5TIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMN. 122
13 -56.7001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  18  4SFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVN. 125
14 -56.4002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  24  7TLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQN. 127
15 -56.2004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  20  35TFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVN. 153
16 -55.6002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  22  5TLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVN. 122
17 -55.6005v3t_A mol:protein length:132 Globin  ali model follow..  20  7TPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVN. 124
18 -48.6001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  19  7APYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVN. 123
19 -47.2004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  17  26NLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVA. 146
20 -46.9004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  12  52KKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMIN. 171
21 -46.3002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  14  1.MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEE-MKNVILQRAQMIASHFQN. 119
22 -15.7001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  13  20............TGFFDDFYRHFLASPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRASRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKS. 130
23 -14.6004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  12  27........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVD-IQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDI 141
24 -14.4002w31_A mol:protein length:162 GLOBIN  ali model follow..  29........ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSNRYIHNKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDI 141
25 -14.4004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  12  32........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVDDVERTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDI 146
26 -14.1004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  20  32........TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAA---FQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADVTMTAVEM 152
27 -14.1001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  59........QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVDEFIEKRNRSIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI....... 168
28 -14.0004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  74........TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSDD-QQKQIGEIHARIKIPIH-ARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEI 194
29 -12.4005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  18  34........APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPEAYWDRRYRRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKVLDLELAV 152
30 -11.8002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  10  50........EDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSQAWLDYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA....... 177
31 -11.0003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  18  21............DEAGLLFYRRLFDEPKVRPLF-KIDIEKQGRKLMDVLNWIVLNLQDIDARELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIE. 131
32 -10.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  19  22............NEIGLLFYANLFKEPTVSVLFQN-PISSQSRKLMQVLGILVQGIDNLEGQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTA. 132
33 -10.5002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  16  21............EDLTNEFYKIMFNYPEVKPMFNMQISGEQPKALAMAILMAAKNIENLENDKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYID. 132
34 -9.9301vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  17  22............VTITTTFYKNLFAHPEVRPLFDRQESLEQPKALAMTVLAAAQNIENLPAKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQ. 135
35 -9.7201bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  18  19........KANIPQYSVVFYTSILEAPAAKDLFTNPKLTGHAEKLFALVRDSAGQLKASG-AALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK. 142
36 -9.3501jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  15  12STWKDIAGADNGAGVGKECLSKFISHPEMAAVFSDPGVAELGAKVLAQIGVAVSHLGDEG-KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALIS. 143
37 -9.0501eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  17  21...............VGILYAVFKADPSIMAKFGTAPFETHANRIVGFFSKIIGELPNIEANTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFS. 134
38 -9.0001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  15  12STWKDIAGSDNGAGVGKECFTKFLSHHDMAAVFSDPGVADLGAKVLAQIGVAVSHLGDEGKKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALIS. 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.