current user: public

If you have questions about the server, please let us know.

Query: 1dly_A mol:protein length:164 HEMOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MMRTVQLRTLRPCIRAQQQPVRPSTSATAAAATAPAPARKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQLast
1 -75.8001dly_A mol:protein length:164 HEMOGLOBIN  ali model  100  1MMRTVQLRTLRPCIRAQQQPVRPSTSATAAAATAPAPARKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ 164
2 -62.1004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  43  1...................................AADTAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLEQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEA 131
3 -61.1004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  14  1.........MVRVPRERSGTRSALGEASTYPVGAMTSQHDDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPED 157
4 -60.8002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  34  1..............................MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGR--GITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGEST 132
5 -60.6001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  35  1..............................MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGR--GITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGEST 132
6 -60.0006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  40  1..........................................STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLNRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYK 124
7 -59.9003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  42  1......................................MNKPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGM--NLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK... 121
8 -58.7002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  15  2...........................................TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE. 123
9 -58.4001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  39  1...........................................SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANM--GVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT.... 115
10 -58.1002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  47  1..........................................ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLNAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVRNDVLNR... 123
11 -57.7001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  45  2..........................................STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELNHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ... 124
12 -56.9004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  13  5.........................LFSKSKPATIEQTPTPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQ... 144
13 -56.2001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  17  1........................................MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP.. 127
14 -55.9005d1v_A mol:protein length:127 Globin  ali model follow..  20  2........................................SEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGE 126
15 -55.8002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  15  2......................................SSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEAD 131
16 -55.6005v3t_A mol:protein length:132 Globin  ali model follow..  23  2......................................SKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNE 128
17 -55.2002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  20  1.......................................EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDH 126
18 -50.9004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  12  16.......HPMACCCKDREKKTAESGSICEARIDFVFPEVKFPSKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRTT 175
19 -49.3004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  13  1..................MQSLQDKASVLSGVDQAEAFAIDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAGNE. 149
20 -47.4001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  18  2......................................GQSFNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEA 127
21 -41.4002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  14  1............................................MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLP--PFPQEFFEIWLKLFEESLNIVYNEEVILQRAQMIASHFQNMLYKYGGH 127
22 -18.2001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  16  1....................................GHMNAADRVMQSYGRCCASTGFFDDFYRHFLASPQIRAKFATTDMTAQKHLLRAGIMNLVRGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYGS 134
23 -16.0001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  15  59...................................................QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI.......... 168
24 -15.5002w31_A mol:protein length:162 GLOBIN  ali model follow..  11  29...................................................ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI.......... 138
25 -15.0004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  74...................................................TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSQALIAQQKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET.......... 187
26 -14.8004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  10  32...................................................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS.......... 143
27 -14.3004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  10  27...................................................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS.......... 138
28 -14.1005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  12  34...................................................APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV.......... 145
29 -13.2002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  13  35......................................TAEDEEYIQKAGEEDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA.......... 177
30 -12.8004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  13  32...................................................TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAAERTVAFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV.......... 145
31 -12.3002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  11  21.......................................................EDLTNEFYKIMFNYPEVKPMFNMEKQISGEQMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEKK 136
32 -11.9003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  16  21.......................................................DEAGLLFYRRLFDEPKVRPLF-KIDIEKQGRKLMDVLNWILQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE... 132
33 -11.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  17  22.......................................................NEIGLLFYANLFKEPTVSVLFQN-PISSQSRKLMQVLGILIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE... 133
34 -11.4001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  11  22.......................................................VTITTTFYKNLFAHPEVRPLFDMGRQESLEQMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVEAD 139
35 -11.3001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  12  11..........................................ASTWKDIAGADNGAGVGKECLSKFISHPEMAAVFSDPGVAELGAKVLAQIGVALGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQS 147
36 -10.7001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  12  11..........................................ASTWKDIAGSDNGAGVGKECFTKFLSHHDMAAVFSDPGVADLGAKVLAQIGVALGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS 147
37 -10.6001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  4......................................SEDQEHYIKGVWKDVDHKQITAKALERVFVYPWTTRLFNDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHTFRPKEHAAAYKFFRLVAEALSSN... 139
38 -10.5001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  13  11..........................................AATWKDIAGADNGAGVGKKCLIKFLSHPQMAAVFSDPGVAALGAKVLAQIGVALGDEGKMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS 147
39 -10.1001eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  14....................................................DKVKGDPVGILYAVFKAPSIMAKFGTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK... 135
40 -10.0001gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  4......................................TQEERDEISKTFQGTDMKTVVTQALDRMFKYPWTNRYFQKRTDFRSSIHAGIVVGALVKHMDDVKTLFKDLSKKHADLHVDPGSFHLLTDCIIVELAYLCFTPHIQGIWDKFFEVVIDAISKQ... 134
41 -9.8803uhc_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQAFLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
42 -9.8802wtg_A mol:protein length:159 GLOBIN-LIKE PROTEIN  ali model follow..  12  20...............................................MVGTEAQNIENGNAFYRYFFTNPDLRVYFKSERFDKQGQRILLACHLLYTNEEVFKGYVRETINRHRIYKMDPALWMAFFTVFTGYLESGSLNDQQKAAWMALGKEFNAESQTHLKN 153
43 -9.8402r4x_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGVSITLMYALQNFLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
44 -9.7903uhb_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
45 -9.7802d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  10  21...................................................AENRAAFSRDLFSELFNQGSSRALFSGVGVDDMNSGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTH-LDCFNQHAWGECYERIASGISG.... 140
46 -9.7603uhd_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
47 -9.7503uhi_A mol:protein length:146 Globin-1  ali model follow..  12  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
48 -9.7502grf_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALVTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
49 -9.7403ugz_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVAAMTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
50 -9.7201hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
51 -9.6903ugy_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNYLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
52 -9.6702auo_A mol:protein length:146 Globin I  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
53 -9.6603uh6_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSIALMYALQNFLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
54 -9.5602r4z_A mol:protein length:146 Globin-1  ali model follow..  11  19..........................................RDSWKVW--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL...... 146
55 -9.5104u8u_D mol:protein length:141 Globin d Chain  ali model follow..  21...................................................GHHRVQFGLELWKRFFDHPEVKGLFKSPEFAAHAERVLSGLDMTLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQDAWTKCFHTIADGIKG.... 141
56 -9.4704u8u_B mol:protein length:142 Globin b Chain  ali model follow..  15  23....................................................HNREDFAQAIWRALFAVPDSRTLFTSPEFQAHALRVLAGFDIALDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKDAWSACFDHIAHGIKG.... 142
57 -9.4002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  12  1..............................AVLTQTQIDSILADLAHHTDTTEHITEMGVSIYKTLFAAPEYISYFSKLQ-EGIRYYGRTLGEELASNPSVLEERIVQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQEDKDAIEKFLLHVMQAIAAK... 147
58 -9.3603mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  4......................................TQEERDEIVKTFFSANSSAIGTKALERMFVFPWTNAYFAKXXXFSASIHAAIVVGALVKHEDDVKAEFVNISKAHAKLHIDPGSFHLLTDSFIVELAHLAFTPFVFAVWIKFFQVVIDAISSQ... 134
59 -9.3103pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  11  1..............................SSGLTGPQKAALKSSWSRF--MNNAVTNGTNFYMDLFKAPDTLTPFKHPTMKAQSLVFCNGMSSFLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDCHVEGSTKNAWEDFIAYICRVQGDFMKE 150
60 -9.3001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  14  13..........................................KSEWGRAGSGHDREAFSQAIWRATFAVPESRSLFSHPAFIAHADRVLGGLDIALDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKG.... 143
61 -9.1901yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  12  11..........................................KDEWAKAYGGAARSKFGDALWRNVFNAPNARDIFESPEFKAHIARVLGGLDRVLDNQATLDADLAHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVCFDVPAWQGCYNIIAKGITGSDA. 144
62 -9.1203wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  11..........................................KMQWAKA--GTERAKFGNSLWTSIFNAPDARDLFKSVK-PQFKAHIARVIGGLFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLPAWESCYKVIAMGITGNDM. 144
63 -9.0701gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  13  19...................................................NANIPKHTHRFFILVLEAPAAKDLFNNPELQAHAGKVFKLVYEAAIGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMDD 151
64 -9.0701bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  14  19...................................................KANIPQYSVVFYTSILEAPAAKDLFTNPKLTGHAEKLFALVRDSAGQ--------AALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK.... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.