current user: public

If you have questions about the server, please let us know.

Query: 1elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MTMITPSLHQFPGLANKTYFNFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGNYPVRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPTYVGWRSITYGAKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADFGPLast
1 -121.0001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model  100  1MTMITPSLHQFPGLANKTYFNFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGNYPVRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPTYVGWRSITYGAKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADFGP 390
2 -87.6005i90_A mol:protein length:427 PvdN  ali model follow..  22  39..KWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRNPGEADWHREEIWKYEDEARAWAGRYFAVQPGQVALTGSTTDGLAAIYGGLLVQPGKEILTSSHEHYSTYTTLEYRHKRMGTQVREFPLFKDVSADEILSSIAAQIRPQTRVLGMTWVQSGSGVKLPIREIGKLVRELNQKRRIIYVVDGVHGFGVEDVSFADFDCDYFIAGTHKWLFGPRGTGVIIARSEQLQEHLVPSIPTFSRADNF---------GTLMTPGGYHAFEHRLALGTAFELHLQLGKAEVQ-ARIHQLNAYLKQRLGEHPKVRLVTPTSPSSGFTFFRVEGRDCEA-VAKHLMAHRVISDAVDRDPVVRLAPSLLNDEAEIDRVLEILAPQ.. 425
3 -84.8005vpr_A mol:protein length:414 Cysteine desulfurase  ali model follow..  24  3MFDIQEIRSQFPILQELVYLDNAATSQKPKMVLDAINNYYEHYNANVHRGHTLSQVATEMMEDARKKVQRFINAHDYEVLFTKGTTEGINLVAYAMTIKKDDEIIISYLEHHSNIVPWQMLCQRTGAKLRVIPMNE--DGTLQIDVLDEWLSEKTKLVSVNQVSNALGIVNPIDEIIRKVRAKS---NAFIFIDGAQAAPHFEIDVQTMDCDFFAFSGHK-MYGPTGTGILYGKASVLEQLNPFHGGGEMID-HCTFEKTTYAGLPFRFEAGTPNIAGNIAIGTAVDFMEKVGRSNIA-AHEHALLEYAQRKLLEIEGLKVYGEKANRAGVVSFNLSGIGIASDVGMILDKLGIAVRTGHHCGTVRASFAVYNTFEEIDILTEGVKKAQ. 404
4 -83.8005b7s_A mol:protein length:419 Cysteine desulfurase  ali model follow..  22  15MRIPEDVRKDIPLTNEVIYFDNTATSLTPKPVVEAMDEYYLKYRANVHRGHRLSQMATHKYEESRKIVADFIGAKFEEIVFTKNTSESLNLVALGLGFKRGDKIVTTPYEHHSDLLPWQRLATKLGLKLEFIEGDD--EGNLDLSDAEKKIK-GAKLVAVQHVSNALGVIHEVEELGKIAKDEG----AIFVVDAAQSAGHMEVNVKKLHADFLAFSGHKGPMGPTGIGVLYIREEFFDTFEPPLIGGGTIE-DVSLDGYKLTEPPERFEAGTPNIGGAIGLAAGIRYIERIGLGRIE-RQEHKLVKRTTEGLDELEVPWYGPRNKKHAGVVSFNVPGLHPHD-VAAILDDHSIMVRSGHHCGTVRASFHVYNSLEEVETFLGVMEELV. 408
5 -80.0001c0n_A mol:protein length:406 PROTEIN (CSDB PROTEIN)  ali model follow..  22  2IFSVDAVRADFPVLSRLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHAGHTLSAQATEKMENVRKRASLFINASAEELVFVRGTTEGINLVANSWGVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNP--DGTLQLETLPTLFDAATRLLAITHVSNVLGTENPLAEMITLAHQHG----AKVLVDGAQAVMHHPVDVQALDCDFYVFSGHK-LYGPTGIGILYVKEALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIA-EYEQNLMHYALSQLESVPDLTLYGP-QARLGVIAFNLGAHHAYD-VGSFLDNYGIAVRTGHHCAMCRASLAMYNTHEEVDRLVTGLQRIH. 402
6 -79.8006c9e_A mol:protein length:422 Cysteine desulfurase  ali model follow..  21  13.FDVNKIRKDFPVLHQLVYFDNAATTQKPKAVIDAIAQFYEKDNSNVHRGHALSVRATEMYEAARAKVKRFINASPRECIFVRGTTEAINLVAQSLRILPDEEILITHMEHHSNIVPWQMVCKKMGCKLQVAPISL--NGEVILEEFERKLNENTKMVAINYASNSLGTINPVKTMIKMAHEVG----AKVLLDGAQATAHLIVDVQDLDCDFYAFSGHK-MYGPTGIGVLWGKEELLNSMTPYQGGGEMIN-SVSFEATEYAAIPHKFEAGTPNIAGAIGLAAAIDYIWSLDLDAIA-EYETQLLNYATKAIEAVKGYNIIGTAANKVPIISFVHGKIHAHD-IGTILDSEGIAIRSGHHCATSRISMSFYNTFKEIDYCMEALQRV.. 411
7 -79.7004w91_A mol:protein length:422 Aminotransferase  ali model follow..  24  13.YDVEAIRRDFPILSRLVYLDNGASAQKPQSVIDAVTHAYANEYANVHRGHFLSNAATDAYEKSRETVRRFLNASVDEIVFTKNATEAINTVAYGYGIGEGDEILLSIMEHHSNIVPWHFIRERQGAKLVFTPVDD--NGVFHIEEFEKRLSERTKLVAITHMSNTLGTVVPIKKIVELAHARG----IPVLVDGSQGAVHLPVDVQDLGCDWYVFTGHK-VYGPSGIGVLYGRAQMLEKMRPFQGGGEMIE-EVTEENVTYNHPPHRFEAGTPPIVQAIGLGAALEYMEKIGRHAIL-AHEADLRDYAHERLGRINSLRIFGNAPDKGAIISFALEGIHAHD-VSMVIDRAGVAVRAGTHCSTCRASFALYNTRAEVDALAEALEKA.. 411
8 -79.7001jf9_A mol:protein length:408 SELENOCYSTEINE LYASE  ali model follow..  23  4IFSVDKVRADFPVLSRLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGHTLSAQATEKMENVRKRASLFINASAEELVFVRGTTEGINLVANSWGVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNP--DGTLQLETLPTLFDEKTRLLAITHVSNVLGTENPLAEMITLAHQHG----AKVLVDGAQAVMHHPVDVQALDCDFYVFSGHK-LYGPTGIGILYVKEALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIA-EYEQNLMHYALSQLESVPDLTLYGP-QNRLGVIAFNLGKHHAYD-VGSFLDNYGIAVRTGHHCAMCRASLAMYNTHEEVDRLVTGLQRIH. 404
9 -79.4005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  16  35....NSLLKEFVLDPAYRNLNHGSFGTIPSAIQQKLRSYQTAAEARP--CPFLRYQTPVLLDESRAAVANLLKVPVETVVFVANATMGVNTVLRNIVWDGKDEILYFDTIYGAKTIDYVIEDKRGIVSSRCIPLIYPAEDDDVVAAFRDAIGKRPRLAVIDVVSSMPGVRFPFEDIVKICKEEE----IISCVDGAQGIGMVDLKITETDPDFLISNCHKWLFTPRGCAVFYVPVRNQHLIRSTLPTSHGFVNPLVPAGNKSAFVSNFEFVGTVDNSPFFCVKDAIKWREEVGGEERIMEYMTKLAREGGQKVAEILGTRVLENSTGTCAMVNIALPFVVGEDPKAVLQDEFNTFVPMTFHRRRARLSAQVYLEMSDFEWAGKTLKELC. 468
10 -79.2001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  17  15..SLAPLRQQFALPEGVIYLDGNSLGARPVAALARAQAVIAEEWGNGLIRSWNSAGWRDLSERLGNRLATLIGARDGEVVVTDTTSINLFKVLSAARSPERRVIVTETSNFPTDLYIAEGLADMLQQGYTLRLV-------DSPEELPQAIDQDTAVVMLTHVNYKTGYMHDMQALTALSHECG----ALAIWDLAHSAGAVPVDLHQAGADYAIGCTYKYLNGPGSQAFVWVSPQLCDLVPQPLSGWFGHSRQFAMEPYEPSNGIARYLCGTQPITSLAMVECGLDVFAQTDMASLR-RKSLALTDLFIELVEQRHELTLVTPREHRGSHVSFEHPEG---YAVIQALIDRGVIGDY-REPRIMRFGFPLYTTFTEVWDAVQILGEI.. 398
11 -79.0002hzp_A mol:protein length:501 Kynureninase  ali model follow..  14  84..LPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVNLHLLMLSFPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKG----CYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNGAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFKKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKALR-KKSVLLTGYLEYLIKHNPVVNIITPSHVRGCQLTITFSV--PNKDVFQELEKRGVVCDK-RNPNGIRVAPPLYNSFHDVYKFTNLLTSI.. 487
12 -77.6004q75_A mol:protein length:429 Cysteine desulfurase 2, chloroplastic  ali model follow..  22  17VSLGHRVRKDFRILHQLVYLDSAATSQKPAAVLDALQNYYEFYNSNVHRGHYLSAKATDEFELARKKVARFINADSREIVFTRNATEAINLVAYSWGLKPGDEVILTVAEHHSCIVPWQIVSQKTGAVLKFVTLNE--DEVPDINKLRELISPKTKLVAVHHVSNVLASSLPIEEIVVWAHDVG----AKVLVDACQSVPHMVVDVQKLNADFLVASSHK-MCGPTGIGFLYGKSDLLHSMPPFLGGGEMIS-DVFLDHSTYAEPPSRFEAGTPAIGEAIALGAAVDYLSGIGMPKIH-EYEVEIGKYLYEKLSSLPDVRIYGPRPHRGALCSFNVEGLHPTDLATFLDQQHGVAIRSGHHCASARASLYFYNTKDDVDAFIVALADT.. 421
13 -77.1004lw2_A mol:protein length:404 Cysteine sulfinate desulfinase  ali model follow..  22  6VFNPAQFRAQFPALQDGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSFAEAQRLTARYEAAREKVAQLLNADDKTIVWTRGTTESINMVAQCYALQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNA--QRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAG----MVVMVDGAQGAVHFPADVQQLDIDFYAFSGHK-LYGPTGIGVLYGKSELLEAMSPWLGGGKMVH-EVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAE-SWSRSLATLAEDALAKRPGFRSFRC--QDSSLLAFDFAGVHHSD-MVTLLAEYGIALRAGQHCGTLRASFAPYNTKSDVDALVNAVDRA.. 398
14 -76.8003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  14  5.YDVARVRGLHPSLGDWVHFDAPAGMLIPDSVATTVSTAFRRSGASTVGAHPSARRSAAVLDAAREAVADLVNADPGGVVLGADRAVLLSLLAEASSAGLGYEVIVSRLDDEANIAPWLRAAHRYGAKVKWAEVDIE-TGELPTWQWESLISKSTRLVAVNSASGTLGGVTDLRAMTKLVHDVG----ALVVVDHSAAAPYRLLDIRETDADVVTVNAHA-WGGPPIGAMVFRDPSVMNSFGSV-------------STNPYATGPARLEIGVHQFGLLAGVVASIEYLAALDESQSADAYLNRVFDYLMVSLRSLPLVMLIGRPEAQIPVVSFAVHKVPADRVVQRLADNGILAIANTGSRGAVTVGLAHYSTMAEVDQLVRALASLG. 400
15 -76.8001t3i_A mol:protein length:420 Probable cysteine desulfurase  ali model follow..  24  8.SLAATVRQDFPILNQLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGHQLSVRATDAYEAVRNKVAKFINASPREIVYTRNATEAINLVAYSWGLKAGDEIITTVMEHHSNLVPWQMVAAKTGAVLKFVQLDE--QESFDLEHFKTLLSEKTKLVTVVHISNTLGCVNPAEEIAQLAHQAG----AKVLVDACQSAPHYPLDVQLIDCDWLVASGHK-MCAPTGIGFLYGKEEILEAMPPFFGGGEMIA-EVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMENIH-NYEVELTHYLWQGLGQIPQLRLYGPNPDRAALASFNVAGLHASD-VATMVDQDGIAIRSGHHCGSARASLYFYNTKEEIDLFLQSLQAT.. 409
16 -76.8005xt5_A mol:protein length:419 Cysteine desulfurase SufS  ali model follow..  23  4.MNITDIREQFPILHQLVYLDSAATSQKPRAVIETLDKYYNQYNSNVHRGHTLGTRATDGYEGAREKVRKFINASMAEIIFTKGTTTSLNMVALSYALKPGDEVVITYMEHHANIIPWQQAVKATGATLKYIPLQE--DGTISLEDVRETVTSNTKIVAVSHVSNVLGTVNPIKEMAKIAHDNG----AVIVVDGAQSTPHMKIDVQDLDCDFFALSSHK-MCGPTGVGVLYGKKALLENMEPAEFGGEMID-FVGLYESTWKELPWKFEAGTPIIAGAIGLGAAIDFLEEIGLDEIS-RHEHKLAAYALERFRQLDGVTVYGP-EERAGLVTFNLDDVHPHD-VATVLDAEGIAVRAGHHCATARASFYLYNTEEEIDKLVEALQKT.. 401
17 -70.4005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  12  28VITLDINLDKYKNLTRINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRLDEVTCPPIKDFLEDIAKFLNM--DCARPTHGAREGKFIVMHAI-CKEGDYVVLDKNAHYTSYVAAERAKLN-VAEVGYEEEYP--TYKINLEGYKEVIGKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKG----IPFLLNCAYTVGRMPVNGKEVKADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFPVK--------------EIEMLGCTSRGLPIVTLMASFPHVVER---VKKWDEELKKTRYVVDELEKIGFKQLGIK-PKEHDLIKFETPVLDEIAKKDKRRG-KKRGIGGIRAGVTKEIKMSVYGLEEQVEYVVNAIKEIV. 407
18 -56.1004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  16  1................MAYFDYTSAKPVDERILEAMLPYMTESFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGY--RKGKHILVSAVEHMSVINPAKFL-QKQGFEVEYIPVGK--YGEVDVSFIDQKLRDDTILVSVQHANNEIGTIQPVEEISEVLAGKA-----ALHIDATASVGQIEVDVEKIGADMLTISSND-IYGPKGVGALWIRKEA--KLQPVILGGGQ---------------ENGLRSGSENVPSIVGFGKAAEITAM---WREEAERLRRLRDRIIDNVLKIEESYLNGHPEKRLNNVNVRFSYIEG-ESIVLSLDMAGIQASTGSACGTLLLTLGRYNTDEDVDRLLEVLRSMSP 378
19 -52.9003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  20  24..............ERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSV--GAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKV-SGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHK-FYGPR-IGALYIRGLGEFPLYPMLFGGGQ---------------ERNFRPGTENTPMIAGLGKAAELVTQ----EAYEAHMRDVRDYLEERLEAIHLNSQFPGTQRLPNTCNFSIRGPRL-QGHVVLAQCRVLMASVGAACNALRLSVGRSTTRAEVDLVVQDLKQA.. 432
20 -52.6003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  19  1MGSSGSMYGVYRAMKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPAHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGA--KKGKHIITSKTEHKAVLDTCRQL-EREGFEVTYLAPQR--NGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARG----IIYHVDATQSVGKLPIDLSQLKVDLMSFSGHK-IYGPKGIGALYVRRKPRVRIEAQMHGGGH---------------ERGMRSGTLPVHQIVGMGEAYRIAKE---MATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGANILNVSFNYVEGESLIMAL---KDLAVSSGSACSSIRFSLGRFTTEEEIDYTIELLRDLSP 398
21 -51.7001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  19  3.................VYFDNNATTRVDDRVLEEMIVFYREKYGNPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTV--KRKRTIITTPIEHKAVLETMKYL-SMKGFKVKYVPVDS--RGVVKLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDVTRIVKKKNK--ETLVHVDAVQTIGKIPFSLEKLEVDYASFSAHK-FHGPKGVGITYIRKGV--PIRPLIHGGGQ---------------ERGLRSGTQNVPGIVGAARAMEIAVE---LSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRG-STLQNLLSGYGIYVSTSSACGAIRISLCKYNTEEEVDYFLKKIEEI.. 372
22 -50.4005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  19  1.............MVQRIYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDDDVIITSCATESNNWVLKGV--KGKNHIVTTVAEHPAVRSTCNFL-ESLGVEVTYLPINE--HGSITAEQVREAITEKTALVSVMWANNETGLIFPIEEIGAICKEKG----VLFHTDAVQAIGKIPVDVLKANADFLSFSAHK-FHGPKGIGGLYIRSGV--GLTPLFHGGEH---------------MNGRRSGTLNVPYIVGMGEAMKLAVE----DYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRVNTTLVSVRGIEG-EAMLWDLNRSNIAASTGSACTAIRLSLSRFNTEAEIDKTIEVLRNISS 385
23 -50.0003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  20  17..............NRKVYMDYNATTPLEPEVIQAVTEAMKEAWGNPSSSYVAGRKAKDIINTARASLAKMIGGKPQDIIFTSGGTESNNLVIHST--GTRPHFITCTVEHDSIRLPLEHLVEDQVAEVTFVPVSKV-NGQVEVEDILAAVRPTTCLVTIMLANNETGVIMPISEISRRIKALNQIRRVLVHTDAAQALGKRRVDVEDLGVDFLTIVGHK-FYGPR-IGALYVRGVGKLPLYPMLFGGGQ---------------ERNFRPGTENTPMIAGLGKAADLVSE----ETYEAHMRDIRDYLEERLEAEKRIHLNSRFPGVERLCNFSIQGSQL-RGYMVLAQCQTLLASVGASCNAVRLSVGRSTTRAEVDLIVQDLKQA.. 424
24 -50.0005usr_A mol:protein length:426 Cysteine desulfurase, mitochondrial  ali model follow..  20  18.............MLRPLYMDVQATTPLDPRVLDAMLPYLINYYGNPHSRHAYGWESEAAMERARQQVASLIGADPREIIFTSGATESNNIAIKGV--SRKKHLITTQTEHKCVLDSCRSL-EAEGFQVTYLPVQK--SGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSSRK----VYFHTDAAQAVGKIPLDVNDMKIDLMSISGHK-IYGPKGVGAIYIRRRPRVRVEALQSGGGQ---------------ERGMRSGTVPTPLVVGLGAACEVAQQ---MEYDHKRISKLSERLIQNIKSLPDVVMNGDPKHHYGCINLSFAYVEGESLLMAL---KDVALSSGSACSSIRFGIGRFTTEEEVDYTVEKLREMSP 401
25 -49.4004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  16  2...............AMIYLDHNATTFIDPRVKEFIISLMDKE-LNPSSAHSSGRFAKNLIETVRAQIATALGSREYDITFTSSGTEGNNLIMKNF---YDGDIFISAIEHLSIYNHI-----NYAPNIKVISVNT--QGLVDLEHLEELLAQSNKLVSIIMANNESGVLQDIAEIGKITKKYE----AKFHSDLVQGFGRIPINIKALGLDFATISGHK-IGGGQGGAALISSSNF--QITPMIIGGGQ---------------EKSVRSGTENVLAIAGFGLASALRTD----SENYIKIKKLQENLEKKLKKYPNVNIVSNNVARLNTTLITIPNTDA-QAKLIGFDLHNICVSSGSACSSIRISLSHTNTVRDIEAFIEAFEEI.. 368
26 -49.2004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  20  4..............SGSAYLDHAATTPMHPAAIEAMAAVQRTI-GNASSLHTSGRSARRRIEEARELIADKLGARPSEVIFTAGGTESDNLAVKGI--PHRRRIVTTEVEHHAVLDSVNWLVEHEGAHVTWLPTAA--DGSVSATALREALQSDVALVSVMWANNEVGTILPIAEMSVVAMEFG----VPMHSDAIQAVGQLPLDFGASGLSAMSVAGHK-FGGPPGVGALLLRRDV--TCVPLMHGGGQ---------------ERDIRSGTPDVASAVGMATAAQIAVD----EENSARLRLLRDRLVEGVAEIDDVCLNGADDPMRGNAHFTFRGCEG-DALLMLLDANGIECSTGSACGSLRLSLGHTSVEADVDAALEVLPGA.. 382
27 -48.6003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  17  12.............GSHMTYLDAAATTRVDQRVADIVLHWMTAEFGNAGSRHEYGIRAKRGVERAREYLASTVSAEPDELIFTSGATESNNIALLGL--TGRRHIITSAIEHKAVLEPLEHLAGR-GFEVDFLTPGP--SGRISVEGVMERLRPDTLLVSLMHVNNETGVIQPVAELAQQLRATP----TYLHVDAAQGYGKVPGDL-TTPIDMISISGHK-IGAPKGVGALVTRRREEMPLEPIMFGGGQ---------------ERKLRPGTLPVPLIMGLAEAAKIFEA---HAQWQVAAQDLRSRLLAGLASTSFQVNGDQDHVVPHILNLSFEDVDAEAFLVTL--KDLVAVATGSASKSLRFSWTPGQATDLVEELARGVAKL.. 390
28 -47.7002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  12  7..............KDFINIDPLQTGKLTEEARQALLEWGDGYSVCDFCTTGRLDEIPPIHDFIHNQLPKFLGC--DVARVTNGAREAKFAVMHSL-AKKDAWVVMDENCHYSSYVAA----ERAGLNIALVPKTDYPDYAITPENFAQTIEEEVVLALITYPDGNYGNLPDVKKIAKVCSEYD----VPLLVNGAYAIGRMPVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIV--------------LRRSEKYKNKEVELLGCTARGATIITLMASFPHVRER----KRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHD-LYEISKKAKGGRFFLYRELKSRKIHGIKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEII. 367
29 -42.6001wyt_A mol:protein length:438 glycine dehydrogenase (decarboxylating) subunit 1  ali model follow..  13  45.LPEWKVLEELRRLAAKAFLGGGVRSHHVPPVVQALAARGEFLTAYTPYQPEVSQGVLQATFEYQTMIAELAGLEIANASMYDGATALAEGVLLALRETGRMGVLVSQGVHPEYRAVLRAYLEAVGAKLLTLPLEG--------GRTPLPEVGEEVGAVVVQNPNFLGALEDLGPFAEAAHGAGA----LFVAVADPLSLGVLKPPGAYGADIAVGDGQSL-FGGPHFGFLATKKAFVRQLPGRLVSETVDVETLQAREQYIRRAKAKSNITTNAQLTALMGAMYLAALGPEGLREV-ALKSVEMAHKLHALLLEVPGVRPFTPKP---FFNEFALALPKDPEAVRRALAERGFHVPREYGENLALFAATELHEEEDLLALREALKEV.. 436
30 -31.0003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  11  17........................FTVGPVMSSEEVRAIGAE-----QVPYFRTTEFSSTMLENEKFMLEYAKAPEGSVFMTCSSTGSMEAVVMNC-FTKKDKVLVIDGGSFGH---FVQLCEIHEIPYVALKLE---GKKLTKEKLYEYDNQNFTGLLVNVDETSTAVLYDTMMIGEFCKKNN----MFFVCDCVSAFLADPFNMNECGADVMITGSQKVLACPPGISVIVLAPRGVERVEKSKVRTMYFDLKDALKNQERGQTPF-----TPAVGILLQINERLKEIKKHGGADAEVARIASQAADFRAKIKDL-PFELV-SESPANGVTSVHPTTANAYDIFLKLKDEYGIWICPNGGETIFRVGHIGALTHEDNTTLVNAFKDL.. 364
31 -30.5003ffr_A mol:protein length:362 Phosphoserine aminotransferase SerC  ali model follow..  14  2.............MNNKIYFTPGPSELYPTVRQHMITALDEKIGVISHRS----KKFEEVYKTASDNLKTLLELPSNEVLFLASATEIWERIIQNC-VEKKSFHCVNGS--------FYEFAGELGREAYKEEAA-----GKGFYPADITVPADAEIICLTHNETSSGVSMPVEDINTFRDKNK---DALIFVDAVSSLPYPKFDWTKI--DSVFFSVQKCFGLPAGLGVWILNDRVIEKSKALLAKRKSIGTYHTIPSMLEKARVNQT-PETPNAMNIFLLGKVTGDMLQISADGIRKQT-EEKAALINTYIESSKVFSFGVEDAKLRSMTTIVANTTMLPGEINKILEPFDMAVGAGYGSTQIRIANFPAHSLEQVHKLVQTLKEK.. 360
32 -30.1002dr1_A mol:protein length:386 386aa long hypothetical serine aminotransferase  ali model follow..  13  1.MEIMEFEEAFKEVYEMVKPKYKLFTAGPVACFPEVLEIMKVQMFS-----HRSKEYRKVHMDTVERLREFLEVEKGELLVPSSGTGIMEASIRNG-VSKGGKVLVTIIGAFGK---YKEVVESNGRKAVVLEYE---GKAVKPEDLDDALNPDVEAVTITYNETSTGVLNPLPELAKVAKEHD----KLVFVDAVSAMGGADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMPERGWYFDIPLYVKYLKEKESTP-----TPPMPQVFGINVALRIIEKMGGKEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTITAVLTPPGIKGDEVYEAMRKRGFELAKGYGSKTFRIGHMGYMKFEDIQEMLDNLREV.. 375
33 -30.1001iug_A mol:protein length:352 putative aspartate aminotransferase  ali model follow..  12  5........................LTPGPVRLHPKALEALAR-----PQLHHRTEAAREVFLKARGLLREAFRTEGEVLILTGSGTLAMEALVKNL-FAPGERVLVPVYGKFSE---FYEIALEAGLVVERLDYP-------DTPRPEDVAKEGYAGLLLVHSETSTGALADLPALARAFKEKNP--EGLVGADMVTSLLVGEVALEAMGVDAAASGSQKGLMCPPGLGFVALSPRALERLKPRGYYLDLARELKAQKEGESA---------TPAINLVLAVAAVLEEVLPRLEE--HLALKAWQNALLYGVGEEG-GLRPV-PKRFSPAVAAFYLPEGVPYARVKEAFAQRGAVIAGGQGPKVFRLSLMGAYDRYEALGVAGMFREV.. 344
34 -30.0003ke3_A mol:protein length:379 Putative serine-pyruvate aminotransferase  ali model follow..  13  1.......................GMTALRQDIDPNGLLEYSVVYTDRALNHM-SKAFQEVMNDLLSNLKTVYNAE-AAVIIPGSGTYGMEAVARQL--TIDEDCLIIRNGWFSY---WTQILEKGKFAKSSTVLTKPFAPVDIETAVAKIKEDKSAIVYAPHVETSSGIILSEEYIKALSEAVHSV---GLLVIDCIASGCVWLDMKELGIDVLISAPQKGWSSTPCAGLVMLSAAAIKKVESTESNCFSLDLKQWLTIMRAYENGGHAYHATMPTDSLRQFRDAILEAKEIGFDILRDAQ-WELGNRVRKVLTDK-GIESVAAEGFEAPGVV-VSYTERDDMHKGSAFAEAGLQIAAGDNFKTFRLGLFGLDKLTDIDGTVERFEKA.. 372
35 -30.0002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  14  13...........PLIIPEKIMMGPGPSNCSKRVLTAMTN---------TVLSNFHAELFRTMDEVKDGLRYIFQTENRAMCVSGSAHAGMEAMLSNL-LEEGDRVLIAVNGIWAE---AVEMSERYGADVRTIEGP---DRPFSLETLARAIELQPKCLFLTHGDSSSGLLQPLEGVGQICHQHD----CLLIVDAVASLCGVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSKVFYWDLLLLGNYWGCYDEPKRY-TVASNLIFALREALAQIAEEGLENQIKRR-IECAQILYEGLGKMGLDIFVKDPRHRLPTVT---KGVDWWKVSQYAMNNFSLEVQGGLGPKAWRVGMGECSTVQKIQFYLYGFKES.. 379
36 -29.9002bkw_A mol:protein length:385 ALANINE-GLYOXYLATE AMINOTRANSFERASE 1  ali model follow..  11  9........................LIPGPIILSGAVQKALDVPSLG-----HTSPEFVSIFQRVLKNTRAVFKSAAASFVLAGSGTLGWDIFASNFSKAPNKNVLVVSTGTFSD---FADCLRSYGAQVDVVRPLKIGESVPLELITEKLSQNSYGAVTVTHVDTSTAVLSDLKAISQAIKQTSP--ETFFVVDAVCSIGCEEFEFDEWGVDFALTASQKAIGAPAGLSISLCSSRFMDYALNDSKNGHVHGYFSSTPIMENYEAGKGAYFATPPVQLINSLDVALKEILEEGLHKRWDLH-REMSDWFKDSLVNGLQLTSVSRYPSNMSAHGLTAVYVADPPDVIAFLKSHGVVIAGGIHKKYIRIGHMGVTACNKNLPYMKNCFDL.. 376
37 -29.9002z9u_A mol:protein length:392 Aspartate aminotransferase  ali model follow..  13  13........................LTAGPVNAYPEVLRGLGR-----TVLYDYDPAFQLLYEKVVDKAQKAMRLSNKPVILHGEPVLGLEAAAASL-ISPDDVVLNLASGVYGK---FGYWAKRYSPHLLEIEVP---NEAIDPQAVADMLKPEITVVSVCHHDTPSGTINPIDAIGALVSAHG----AYLIVDAVSSFGGMKTHPEDCKADIYVTGPNKCLGAPPGLTMMGVSERAWAKMKANPLAPRASMLSIVDWENAWSRDKP---PFTPSVSEINGLDVALDLYLNEGPEAVWARH-ALTAKAMRAGVTAMGLSVWAASDSIASPTTT---DGVDEKALRQAARARYGVVFSSGRGEKLTRIGMGPTAQPIYAIAALTALGGA.. 367
38 -29.8002fyf_A mol:protein length:398 phosphoserine aminotransferase  ali model follow..  13  29...........TAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQ----APVKNLVGRVRSGLAELFSLPDG-ILGNGGATAFWDAAAFGL----DKRSLHLTYGEFSA---FASAVSKNPFVGEPIIITSDPGSAPEPQT-----DPSVDVIAWAHNETSTGVAVAVRRPEG-------SDDALVVIDATSGAGGLPVDIAET--DAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAV-ENSLKNQTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKNQLRVAMFPAVEPDDVSALTECVDWV.. 388
39 -29.8005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  16  31........................LGPGPSNLPPRIMAAGGLQMIG-----SMSKDMYQIMDEIKEGIQYVFQTRNPTLVISGSGHCALEAALVNV-LEPGDSFLVGANGIWGQ---AVDIGERIGARVHPMTKD---GGHYTLQEVEEGLAQKPVLLFLTHGESSTGVLQPLDGFGELCHRYK----CLLLVNSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMY-TIPVISLYSLRESLALIAEQGLENSWRQH-REAAAYLHGRLQALGLQLFVKDPALRLPTVT---AGYDWRDIVSYVIDHFDIEIMGGLGPKVLRIGLGCNATRENVDRVTEALRAA.. 388
40 -29.6003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  16  27........................LGPGPSNLAPRVLAAGSLRMIG-----HMQKEMLQIMEEIKQGIQYVFQTRNPTLVVSGSGHCAMETALFNL-LEPGDSFLTGTNGIWGM---AAEIADRIGARVHQMIKK---GEHYTLQEVEEGLAQKPVLLFLVHGESSTGVVQPLDGFGELCHRYQ----CLLLVDSVASLGGVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKPVSFYTDITYLAKLWGCEGETRVI-TTPVTSLYCLRESLALIAEQGLENCWRRH-REATAHLHKHLQEMGLKFFVKDPEIRLPTIT---AGYNWRDIVSYVLDHFSIEISGGLGPRVLRIGLGYNATTENVDRVAEALREA.. 384
41 -29.6001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  16  8........................LTPGPLTTSRTVKEAMLF-----DSCTWDDDYNIGVVEQIRQQLTALATASEGYVLLQGSGSYAVEAVLGSA-LGPQDKVLIVSNGAYGA---MVEMAGLMGIAHHAYDCG---VARPDVQAIDAILDPTISHIAMVHSETTTGMLNPIDEVGALAHRYG----KTYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACK----GHSRSLSLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITAFYSPEDPQYREFYRRLKEQGFVIYPGKQSDCFRIGNIGEVYAADITALLTAIRTA.. 361
42 -29.4002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  16  26........................LGPGPSNLPPRIMAAGGLQMIG-----SMSKDMYQIMDEIKEGIQYVFQTRNPTLVISGSGHCALEAALVNV-LEPGDSFLVGANGIWGQ---AVDIGERIGARVHPMTKD---GGHYTLQEVEEGLAQKPVLLFLTHGESSTGVLQPLDGFGELCHRYK----CLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMY-TIPVISLYSLRESLALIAEQGLENSWRQH-REAAAYLHGRLQALGLQLFVKDPALRLPTVT---AGYDWRDIVSYVMDHFDIEIMGGLGPKVLRIGLGCNATRENVDRVTEALRAA.. 383
43 -29.2002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  16  14...........PLVTPNKLLMGPGPSNAPQRVLDAMSR---------PILGHLHPETLKIMDDIKEGVRYLFQTNNIAFCLSASGHGGMEATLCNL-LEDGDVILIGHTGHWGD---SADMATRYGADVRVVKSK---GQSLSLDEIRDALLIKPSVLFLTQGDSSTGVLQGLEGVGALCHQHN----CLLIVDTVASLGGAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKVKVYYWDMSLVGDYWGCFGRPRIY-TISSTLLYGLREAIAMACEEGLPALIARH-EDCAKRLYRGLQDA-GFELYADPKDRLSTVT---QGVDWLKAAQYAMKTYLVEISGGLGPQVFRIGMGQNATTERVDRVLQVFQEA.. 379
44 -29.2004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  16  28........................LGPGPSNLPPRIMAAGGLQMIG-----SMSKDMYQIMDEIKEGIQYVFQTRNPTLVISGSGHCALEAALVNV-LEPGDSFLVGANGIWGQ---AVDIGERIGARVHPMTKD---GGHYTLQEVEEGLAQKPVLLFLTHGESSTGVLQPLDGFGELCHRYK----CLLLVDSVAFLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMY-TIPVISLYSLRESLALIAEQGLENSWRQH-REAAAYLHGRLQALGLQLFVKDPALRLPTVT---AGYDWRDIVSYVIDHFDIEIMGGLGPKVLRIGLGCNATRENVDRVTEALRAA.. 385
45 -29.2004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  16  26........................LGPGPSNLPPRIMAAGGLQMIG-----HMSKEMYQIMDEIKEGIQYVFQTRNPTLVISGSGHCALEAALVNV-LEPGDSFLVGANGIWGQ---AVDIGERIGARVHPMTKD---GGHYTLQEVEEGLAQKPVLLFLTHGESSTGVLQPLDGFGELCHRYK----CLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMY-TIPVISLYSLRESLALIAEQGLENSWRQH-REAAAYLHGRLQALGLQLFVKDPALRLPTVT---AGYDWRDIVSYVMDHFDIEIMGGLGPKVLRIGLGCNATRENVDRVTEALRAA.. 383
46 -29.1001vjo_A mol:protein length:393 alanine--glyoxylate aminotransferase  ali model follow..  16  32........................LGPGPSNAHPSVLQAMNVSPVG-----HLDPAFLALMDEIQSLLRYVWQTENP-IAVSGTGTAAMEATIANA-VEPGDVVLIGVAGYFGN---LVDMAGRYGADVRTISKP---GEVFSLEELRTALETRPAILALVHAETSTGARQPLEGVGELCREFG----TLLLVDTVTSLGGVPIFLDAWGVDLAYSCSQKGLGCSPGASPFTMSSRAIEKLQRRRTKVANWYLDMNLLGKYWGSERV-----TAPINLYYALREALRLIAQEGLANCWQRH-QKNVEYLWERLEDI-GLSLHVEKEYRLPTLT---DGVDGKAVARRLLNEHNIEVGGGLGEKVWRVGMGFNSRKESVDQLIPALEQV.. 385
47 -29.0002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  15  4........................LTPGPTPIPERVQKALLRPMRG-----HLDPEVLRVNRAIQERLAALFDPGEGAAALAGSGSLGMEAGLANL---DRGPVLVLVNGAFSQ---VAEMAALHGLDPEVLDFP---GEPVDPEAVARALKRRYRMVALVHGETSTGVLNPAEAIGALAKEAG----ALFFLDAVTTLGMLPFSMRAMGVDYAFTGSQKCLSAPPGLAPIAASLEARKAFTGKRGWYLDLARVAEHWERGGYH--------TTPVLLHYALLEALDLVLEEGVAARERRA-REVYAWVLEELKAR-GFRPYPKASPLPTVLVVRPPEGVDADRLVRALYAEGVAVAGGIGPQVLRLGMGEGARREAYQAFLKALDRA.. 349
48 -28.8003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  15  17........................MGPGPINADPRVLRAMSSQLIG-----QYDPAMTHYMNEVMALYRGVFRTENRWMLVDGTSRAGIEAILVSA-IRPGDKVLVPVFGRFGH---LCEIARRCRAEVHTIEVP---GEVFTPDQVEDAVKRRPRLLLTVQGDTSTTMLQPLAELGEICRRYD----ALFYTDATASLGGNPLETDVWGLDAVSAGMQKCLGGPSGTSPITLSARMEEAIRRRKCVEEGIRTDAHRDGDEEMIYSNYFDL-TEATTALFGARECARLILQEGLDYGIARH-KLHGDALVKGIQAM-GLETFGDLKHKMNNVL---QGINGDQARKLMLEDFGIEIGTSFGPKVWRIGMGYNARKDCVMTTLSALEAV.. 386
49 -28.6003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  14  1......MSGRRELCTPLRTIMTPGPVEVDPRVLRVMST---------PVVGQFDPAFTGIMNETMEMLRELFQTKNRWYPIDGTSRAGIEAVLASV-IEPEDDVLIPIYGRFGY---LTEIAERYGANVHMLECE---GTVFDPEDIIREIKKKPKIVAMVHGETSTGRIHPLKAIGEACRTED----ALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERGIATQADRAALSGNRPITSNYFDTEATTMLYALREGVRLVLEEGLETRFERH-RHHEAALAAGIKAM-GLRLFGDDSCKMPVVT---GGIDGESVRDMLLAQFGIEIASSFGPKIWRIGMGYSCRKENVLFVLAGLEAV.. 386
50 -28.5003qbo_A mol:protein length:364 Phosphoserine aminotransferase  ali model follow..  14  5...............TQVYNFSAGPAMLPVEVLRRAQQELRDWHGLGTSVMEVSKEFMQVAEESEKDLRDLLNVPAN-LFCHGGARAQFAAVPLNL-LGDRNSADYVDGGYWAH---AIKEAQKYCTPNVIDVTTHDNGLTGIQPMKQWKLSDNAAYVHYCPNETIDGIAIDEQP---------DFGNKVVVADFSSSILSRPIDVSRY--GVIYAGAQKNI-GPAGLTLVIVREDLLGKAHTALPSILDYKILADNDSMFN----------TPPTFAWYLSGLVFKWLKEQGGLGEMEKRNQAKAELLYGAIDRTGFYRNDVAITNRSWNVPFQMADASLDKLFLSEAEAQGLQALKGHRVGGMRASIYNAMPIEGVKALTDFMADF.. 359
51 -27.5002bie_A mol:protein length:361 PHOSPHOSERINE AMINOTRANSFERASE  ali model follow..  12  1.............MVKQVFNFNAGPSALPKPALERAQKELLNFNDTQ---SHRSQSYEEVHEQAQNLLRELLQIPND-LFLQGGASLQFTMLPMNL-LTKGTIGNYVLTGSWSE---ALKEAKLLGETHIAASTKAN-SYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFP---------EINHAPLIADMSSDILSRPLKVNQF--GMIYAGAQKNL-GPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSL----------YNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSGGCRASIYNAVPIDACIALRELMIQF.. 357
52 -27.4003zrp_A mol:protein length:384 SERINE-PYRUVATE AMINOTRANSFERASE (AGXT)  ali model follow..  14  1...................MDKLLLHVGPTTIKEDVLVAGLENNVG-----FTSKEFVEALAYSLKGLRYVMGASKNYLIIPGGGTSAMESVTSLL--KPNDKILVVSNGVFGD---WEQIFKRYPVNVKVLRPS---GDYVKPGEVEEEVKSEYKLVALTHVETSTGVREPVKDVINKIRKYV----ELIVVDGVSSVGAEEVKAEEWNVDVYLTASQKALGSAAGLGLLLLSPKALSILDSQNSIAGYYLDLRNWLPVMRGAEEGKAAYATPPVHVILQLAEAFRLIEKEGIENRIKRH-TMVASAIRAGLEALGLEIVARRPESYSNTVTGVILKVADPQKVLAGTVNEGVEFAPGVHPAYFRIGHMGWVTPNDAIIAISVIERT.. 359
53 -26.8003qm2_A mol:protein length:386 Phosphoserine aminotransferase  ali model follow..  13  9...TENLYFQSNAMAQVFNFSSG--AMLPAEVLKLAQQELCDWHGLG---SHRGKEFIQVAEEAEQDFRDLLNIPSN-LFCHGGGRGQFAGVPLNL-LGDKTTADYVDAGYWAA---AIKEAKKYCAPQIIDAKITVDGKRAVKPMREWQLSDNAAYLHYCPNETIDGIAIDETPDFG--------PEVVVTADFSSTILSAPLDVSRY--GVIYAGAQKNI-GPAGLTLVIVREDLLGKAHESCPSILDYTVLNDNDSM----------FNTPPTFAWYLSGLVFKWLKAQGGVAAMHKINQQKAELLYGVIDNSDFYRNDVAQANRSRNVPFQLADNTLDKVFLEESFAAGLHALKGHRVGGMRASIYNAMPIEGVKALTDFMIDF.. 375
54 -26.6003e77_A mol:protein length:377 Phosphoserine aminotransferase  ali model follow..  13  1.............MSSGVDLGTENLSMLPHSVLLEIQKELLDYKGVG---SHRSSDFAKIINNTENLVRELLAVPDN-IFLQGGGCGQFSAVPLNLGLKAGRCADYVVTGAWSA---AAEEAKKFGTINIVHPKLGSYTKIPDPSTWN--LNPDASYVYYCANETVHGVEFDFIP---------DVKGAVLVCDMSSNFLSKPVDVSKF--GVIFAGAQKNV-GSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSL----------YNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYPVEPQNRSKMNIPFRIGNAKGDDALEKRFKALELNMLSLKSVGGIRASLYNAVTIEDVQKLAAFMKKF.. 365
55 -26.4001bjn_A mol:protein length:360 PHOSPHOSERINE AMINOTRANSFERASE  ali model follow..  12  6.....................SSGPAMLPAEVLKQAQQELRDWNGLG---SHRGKEFIQVAEEAEKDFRDLLNVPSN-LFCHGGGRGQFAAVPLNI-LGDKTTADYVDAGYWAA---AIKEAKKYCTPNVFDAKVTVDGLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETP--------DFGADVVVAADFSSTILSRPIDVSRY--GVIYAGAQKNI-GPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSM----------FNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKRNRSRNVPFQLADSALDKLFLEESFAAGLHALKGHVVGGMRASIYNAMPLEGVKALTDFMVEF.. 355
56 -26.3001w3u_A mol:protein length:362 PHOSPHOSERINE AMINOTRANSFERASE  ali model follow..  14  1.............MSERAYNFNAGPAALPLEVLERAQAEFVDYQHTG---SHRGAVYEAVHNEAQARLLALLGNPTG-LFIQGGASTQFAMIPMNF-LKEGQTANYVMTGSWAS---ALKEAKLIGDTHVAASSEAS-NYMTLPKLQEIQLQDNAAYLHLTSNETIEGAQFKAFP---------DTGSVPLIGDMSSDILSRPFDLNQF--GLVYAGAQKNL-GPSGVTVVIVREDLVAESPKHLPTMLRYDTYVKNNSL----------YNTPPSFGIYMVNEVLKWIEERGGLEGVQQANRKKASLIYDAIDQSGGFYCVDVDSRSDMNITFRLASEELEKEFVKASEQEGFVGLKGHSVGGLRASIYNAVPYESCEALVQFMEHF.. 357
57 -25.4003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  13  35........................FGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLNNKDAYGHIVSGGTEANLMALKGLSKNEHPKIIVPITAHFS----FEKGREMMDLEYIYAPIKE--DYTIDEKFVKDAVEDYDVDGIIGIATTELGTIDNIEELSKIAKENN----IYIHVDAAFGGLVIPFLDDKLGVDSITIDPHKMGHCPIPSGGILFKDIGYKR-------------YLDVDAPYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKI-VNECMENTLYLYKKLKENNFKPVIEP---ILNIVAIEDE---DYKEVCKKLRDRGIYVSVCNCVKALRIVVMPHIKREHIDNFIEILNSIK. 395
58 -25.2004xk1_A mol:protein length:369 Phosphoserine aminotransferase  ali model follow..  13  1..........MAMSKRAFNFCAG--AALPDAVLQRAQAELLDWRGKG---SHRSDDYVAIASKAEQDLRDLLDIPSD-LFLQGGASQQFAEIPLNL-LPEDGVADYIDTGIWSK---AIEEARRYGTVNVAASAKEY-DYFAIPGQNEWTLTKDAAYVHYASNETIGGLEFDWIP---------ETGDVPLVTDMSSDILSRPLDVSRF--GLIYAGAQKNI-GPSGLVVVIVREDLLGRARSVCPTMLNYKTAADNGSM----------YNTPATYSWYLSGLVFEWLKEQGGVTAMEQRNRAKKDLLYKTIDASDFYTNPIQPSARSWNVPFRLADERLDKPFLEGAEARGLLNLKGHRSGGMRASIYNALGLDAVEALVAYMAEF.. 358
59 -25.1004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  14  96............................EEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDS-CVTSGGTESILMACKAYRDLAFEKIVAPQSAHAA----FNKAASYFGMKIVRVPLTK--MMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYK----IPLHVDACLGGFLIPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNVDTDWQGGIYASPTI---------------AGSRPGGISAACWAALMHFGENGYVEAT-KQIIKTARFLKSELENIKGIFVFG--NPQLSVIALGSRDFDIYR-LSNLMTAKGWNLNQLQFPPSIHFCILLHARKRVAIQFLKDIRESV. 451
60 -24.9003m5u_A mol:protein length:361 Phosphoserine aminotransferase  ali model follow..  10  10.....................SAGPSTLPLEILEQAQKELCDYQGRGYSIMEITKVFEEVHFGAQEKAKKLYELNDDEVLFLQGGASLQFAMIPMN-LALNGVCEYANTGVWTK---AIKEAQILGVNVKTVASS----ESNFDHIPRVEFSDNADYAYICSNNTIYGTQYQNYP----------KTKTPLIVDASSDFFSRKVDFSNI--ALFYGGVQKNA-GISGLSCIFIRKDMLERSKNKQIPSMLNYLTHAENQSLFN---------TPPTFAIYMFNLEMDWLLNQGGLDKVHEKNSQKATMLYECIDLSNGFYHADKKDRSLMNVSFNIKNKDLEPLFVKEAEEAGMIGLKGHRIGGIRASIYNALNLDQVKTLCEFMKEF.. 356
61 -24.6006czx_A mol:protein length:362 Phosphoserine aminotransferase 1, chloroplastic  ali model follow..  12  1.............SNARVFNFAAGPATLPENVLLKAQADLYNWRGSG----HRGKEFLSIIQKAESDLRQLLEIPQE-LFLQGGATTQFAALPLNL-CKSDDTVDFVVTGSWGD---AVKEAKKYCKTNVIWSGKSE-KYTKVPSFEELEQTPDAKYLHICANETIHGVEFKDYPVPK---------NGFLVADMSSNFCSKPVDVSKF--GVIYGGAQKNV-GPSGVTIVIIRKDLIGNAQDITPVMLDYKIHDENSSL----------YNTPPCFGIYMCGLVFEDLLEQGGLKEVEKKNQRKADLLYNAIEESNGF-PVEKSVRSLMNVPFTLEKSELEAEFIKEAAKEKMVQLKGHSVGGMRASIYNAMPLAGVEKLVAFMKDF.. 357
62 -24.2001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  12  43..........FQIINDELYLDGNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPK---TIGSSEACMLGGMAMKWRWRKPNLVCGPVQIC----WHKFARYWDVELREIPMRPG-QLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDQADTGIDIDMHIDAASGGFLAPFDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPFNVDYLGGQIGTFAIN---------------FSRPAGQVIAQYYEFLRLGREGYTKV-QNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDDLSERLRLRGWQVPAATDIVVMRIMCRRGFEMDFAELLLEDYKASL. 445
63 -23.7005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  13  55......................GTMYCGDHEHYAFLNEAYGLFSHVNALQRDLCPSMNRMESEIVAMTVALLHGEAVQ-ALSLGGTESILNATLAYREKERPRMIWPASAHPA----FRKAAHLFGFDVTVAPIDPV-TMQVDADFVRDAVDANTVMLVGSACNYPYGTIDPIGALSAIAVEKD----VWLHVDGCLGGWMLPWGEALGGVTSISADTHKFGYGPKGGSVLAWRDASFRRLMTDWVGGVYGSPGLT---------------GSRSGGLIAATWAALRSLGREGYLARA-KAIFETAFDMQAAVRAIPELRVLGKP-----TFCFAFSDAFDIYHVNDFMRQRGWRFNGLQHPDALHMCVGPQTQPGVAERFRQDLGEAV. 425
64 -23.7003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  70.................................PECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEE-VGTVGSSEAIMLAGLAFKRKWQNKIVTGANVQVC----WEKFARYFEVELKEVKLSEG-YYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNTGWDTPIHVDAASGGFIAPFDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKED-IFHINYLGADQPTFTLN---------------FSKGSSQVIAQYYQLIRLGHEGYRNVM-ENCRENMIVLREGLEKTERFNIVSKDE--VPLVAFSLKDSSCHTEISDMLRRYGWIVPAAQHITVLRVVIREDFSRTLAERLVIDIEKVM. 441
65 -23.6005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  14  1............MTDKSQQFASDNYSGICPEAWAAMEK--------ANHGHDRAYGDDQWTERASEYFRNLFETDC-EVFFAFNGTAA-NSLALASLCQSYHSVICSETAH---VETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALPKPRVVTITQ-ATEVGTVYRLKAISATCKELG----LNLHMDGARACAFLGCSPAELGVDVLCFGGTKNGMAVGE-AILFFNRQLAEDFD------------------------CKQAGQLASKMRF--LSAPWVGLLEDGAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMP-------EHAIEALRAKGWRFYTFIGSGGARFMCSWDTEEERVRELAADIRSI.. 343
66 -23.1005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  13  67............................QTYMEPEAVELMKDTLEKNAIDKSEYPRTAEIENRCVNIIANLWHAPEAE-TSTIGSSEACMLAGLAMKFAWRKRIVISAGYQVC----WEKFCVYWDIDMHVVPMDDD-HMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARLDAVVERYNTKFPVYIHVDAASGGFYTPFDFRLNNVISINASGHKYGLVYPGVGWVIWRDQQYLPFKVSYLGGELPTMAIN---------------FSHSASQLIGQYYNFIRFGFDGYREIQ-EKTHDVARYLAKSLTKLGGFSLIN--DGHELPLICDSDREWTLYDLSDRLLMKGWQVKNMTDRVIQRIVVRADFGMSMAHDFIDDLTQAI. 445
67 -23.0001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  12  70.................................ENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPK---TIGSSEACMLGGMAMK-PTDKPNLVCGPVQIC----WHKFARYWDVELREIPMRPG-QLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDQADTGIDIDMHIDAASGGFLAPFDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPFNVDYLGGQIGTFAIN---------------FSRPAGQVIAQYYEFLRLGREGYTKV-QNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDDLSERLRLRGWQVPAATDIVVMRIMCRRGFEMDFAELLLEDYKASL. 445
68 -22.9003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  17  107......................GAVYHGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDAAG-TVTSGGTESLLLAMKTYR--TAPEAVVPVSAHAA----FDKAAQYFGIKLVRTPLDA--DYRADVAAMREAITPNTVVVAGSAPGYPHGVVDPIPEIAALAAEHG----IGCHVDACLGGFILPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHIAADWPGGLYFSPTF---------------AGSRPGALSATAWAAMLSLGEEGYLDAT-RRILQAADRLKAGVRAIPSLKILGD--PLWVIAVASDE--LNIYQVMEEMAGRGWRLNGLHRPPAFHVALLRHTEPGVVDRFLADLQDAV. 470
69 -22.4005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  16  102.....................SGAVYHGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDAAG-TVTSGGTESLLLAMKTYR--TAPEAVVPVSAHAA----FDKAAQYFGIKLVRTPLDA--DYRADVAAMREAITPNTVVVAGSAPGFPHGVVDPIPEIAALAAEHG----IGCHVDACLGGFILPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHIAADWPGGIYASPTFA---------------GSRPGALSATAWAAMLSLGEEGYLDAT-RRILQAADRLKAGVRAIPSLKILGD--PLWVIAVASDE--LNIYQVMEEMAGRGWRLNGLHRPPAFHVALLRHTEPGVVDRFLADLQDAV. 466
70 -22.2003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  13  49IEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDT-TTTSGGTESLLLACLSAKMYTEPEIIAPVTAHAG----FDKAAYYFGMKLRHVELDPT-TYQVDLGKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQKYK----LPLHVDSCLGSFIVSLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMVNPAWTGGLYGSPTL---------------AGSRPGAIVVGCWATMVNMGENGYIESC-QEIVGAAMKFKKYIQE-PDLDIMG--NPRYSVISFSSKTLNIHE-LSDRLSKKGWHFNALQKPVALHMAFTRLSVDEICDILRTTVQELK. 438
71 -22.1002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  122.....................................................ASIMYALTNKILESFFKQLGLNVHAIATPISTGMSISLCLSAARKKYGSVVIYPYASHKS----PIKAVSFVGMNMRLVEVLDGDRVYVPVEDIENAIKKEIECVLSTLTFFPPRNSDDIVEIAKICENYD----IPHIINGAYAIQNNYYLEKKYRVDAVVSSSDKNLLTPIGGGLVYSTDA------------------------EFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQK-NSKKLLDELLNDLSGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNIVMNAAIGVRTEDIVNSVSKLEKI.. 448
72 -21.9005f8v_A mol:protein length:379 Aminotransferase, class V family protein  ali model follow..  10  1............MSAQRAYNFSAGPAAVPLECLERAAAEMTNWRNSG----HRGKHWMEEQKEATERLRTLLQVPEN-LFVAGGASLQFSAIPFNF-IGEHKAVDYLCTGTWSK---AFDECKRLAFPGVTVNSNPPANPVEVPARDTWKLSEDAAYFYYCDNETIQGIEFQQFP----------DVPAPLIIDMSSNFLSRPI-TQWEKVGCIFACAQKNF-GLAGMSVVIIRKDMLERPVKPFCPITMDYRIQVKNNCMYN---------TPPTFAIYFANHIFKWIEEKGGLAAMDALNKEKAKKVYEAIDSNPNFVNRIKPEWRSRNMPFFRPDGYENKDLDADAKFVNFCTQRKVSVGGFRASCYNACPMEAVDALVQAMKEW.. 368
73 -21.4001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  12  13..............PKPYSFVNDYSVGMHPKILDLMAR--------DNMTQHAGYGQDSHCAKAARLIGELLERPDADVHFISGGTQT-NLIACSLALRPWEAVIATQLGH--------STHETGAIEAHKVVTAPCPDGKLRVADIESALHVIPKLVYISN-TTEVGTQYTLEDISASCKEHG----LYLFLDGARALSSPVNDLTLADTDMFYIGATKAGGMFGE-ALIILNDALKPNAR------------------------IKQRGALMAKGWL--LGIQFEVLMKDNLFFELGAHSNKMAAILKAGLEACGIRLAW---PSASNQLFPILEN-TMIAELNNDFDMYTVEPLKDGT-CIMRLCTSWATEEKECHRFVEVLKRLV. 355
74 -21.3005uid_A mol:protein length:402 Aminotransferase TlmJ  ali model follow..  16  35..........................................................PRTKVFEADFAEHLGVGAEQVVSVSCCTEGLFLSMELLGVGPGDEVVLPSISFVGAANAIAAR----GARPVFCDVDPAT--NPTADHVAEKLGPRTKAVVVLHY---GGYPGDLVAIAELCRERG----VPLVEDSACAVAS-QVDGRACGVGVWSFDAMKILVTGDGGMLCFRDPELAERARKLASLGMAQSSGFANATADAEARWWEFEVTAFGRRSISNDVAASIGSVQLRRLPEFVRRRREIAERYDQGLSTVDGLRCPLPAGHTSSYYFYWVRDASVRDAMARRLYDRGVYTTFRYAPETLCLPLHQALSDSDVETVIGEVRAG.. 379
75 -21.3005k8b_A mol:protein length:403 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase  ali model follow..  14  37..........................................................WKTRDMEQLLCEKMNVK--HAHLLSSGTAALQTAMMAAGIGAGDEVIVPPFTFVASVEAIFMA----GAVPIFAEIDETLC--LSPEGIEAVITPRTKAINLVHM---CGSMAKMDEIKAICKKHN----LVLLEDACQAIGGS--TIGDVGC--YSFDSVKTITCGEG-GAVITNNTEIYDNAHMFSDHGHDHIGKDRGAESHPIMGLNFRISE--------MNAAL--LAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDPEGDFLSFMLPTEARTQEISKKLAANGVDGCFYW-SRTISMLIKLSWTDAQIAERIENIKKA.. 392

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.