current user: public

If you have questions about the server, please let us know.

Query: 1fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst GSHMRGEFYQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIALast
1 -114.0001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model  100  1GSHMRGEFYQQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIA 401
2 -108.0003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  66  1.SNAMQEILSQLNKEIEGLKKAGLYKSERIITSPQNAEIKV-GEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI. 399
3 -107.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  36  1.SKGKLGEKISQFKIVEELKAKGLYAYFRPIQSKQDTEVKI-DGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPED--SAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSL-ASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVE. 395
4 -106.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  33  4.....LSKFDPLIAEREALLATGVRDPYAIVMDKVLSPTEAINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAE--AGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSV-GTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGTAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVIP 399
5 -105.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  33  1...MAMHLLDTLAEGLKEIDARGLRRRRRTADTPCAAHMTV-DGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASD---ADVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA... 396
6 -104.0001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  31  1.....MSWQEKINAALDARRAADALRRRYPVAQGAGRWLVA-DDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCP---GQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG....... 384
7 -104.0005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  33  1.....MNLLDTLQRGLADLDAQGLRRVRRTADSACDAHMTV-NGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACTS---QTKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA.... 393
8 -102.0003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  29  18.TRAGLSPLAWLADIEQRRRAEGLRRELRV----------RPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAARTE---ERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKAL-GSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELAT----IAGVTEAPVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATA.... 396
9 -102.0002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  33  24.....LSKFDGLIAERQKLLDSGVTDPFAIVMEQVKSPTEAIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKE--PAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIG 419
10 -100.0004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  29  14...FQSNAMLNLQDKYTQYQRDNLLRELTPF----------IKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYD-------GKSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAF-GGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIRS 392
11 -100.0004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  33  40.....LSKFDGLIAERQKLLDSGVTDPFAIVMEQVKSPTEAIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKE--PAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIG 435
12 -98.8002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  31  1.....MDYNLALDKAIQKLHDEGRYRTFIDIEREKGAFPKAGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPA--APKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAY-GVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA... 401
13 -97.1005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  30  14.....FDYEGLIDSELQKKRLDKSYRYFNNINRLAKEFPRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKS--VPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSF-GSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLP. 433
14 -95.9002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  23  4.........PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRH-----GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF.. 386
15 -93.4003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  23  20...........LPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRH-----GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF.. 400
16 -29.5002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  16  1..............................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCT-TPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTTPENFAQTIEETKKRG-EVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS... 371
17 -24.7004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  14  1..............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLEN--THNGKVLPLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR..... 333
18 -24.6003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  15  1..............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENVLPRE----YLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR..... 333
19 -24.1005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  52......................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNLEDKGKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFDELKKRGIAGVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK... 411
20 -24.1002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  17  1........................................MGSDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILNLKVNAHGFIEALRNSGVLAN-------AVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS... 349
21 -22.3003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  13  2..........................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--------EVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLEN--THNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQL-TSGESAPLLAFMKARGILF---------SGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA..... 341
22 -20.7001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  13  2.................................STPRTTATAAKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTLEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS..... 357
23 -20.2003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  12  14.......................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEIKALPDIACLLLELPQREIGGVAPALETISRYCRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL.... 352
24 -20.1004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  15  21...................................................MRESIKLIASENITSLAVREAHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLK--DADAMVKKILEEKP----KLILFGGSLFPFP---HPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKD-IESSPDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEGMKEKEMEEIAEFMKRIAID..... 392
25 -19.9001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  17  22...................................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGMNLSHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLHRP----KLIVAAASAYPRI----DFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLVSGGTDLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAGFGLEEMDEIAAIIGLVLKN..... 386
26 -19.6003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  17  38...................................................QRDTLEMIASENFVPRAVLQANKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEFRP----KVIIAGWSAYPRV---LDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKGGTDVHLVLVDLRDSPDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAGFGDTEFTEVADIIATALAT..... 407
27 -19.6001v72_A mol:protein length:356 Aldolase  ali model follow..  13  5..........................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVGDVHTTQPACVSITQATEVTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAE-MTWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLT-DDLWLRNARKANAAAQRLAQGLEGLG--LGGTEANILFCRLDSA-----MIDALLKAGFGFY-----HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ... 354
28 -19.5005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  11  4.............................................KSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHVETDECEFFSNGSKLLTAASTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRLKAISATCKELGLNLHMDGARFTNACAFLGCSPAE-LTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE------RHGNHANHCAQLLALLVSDLP--MFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT...... 345
29 -19.4001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  12  25............................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAY-YHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIA--YICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDIR 435
30 -19.3006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  17  44..............................FVEGSGAYLTDPDGRRWIDFDNA-VLG--GDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHGYHCDEPFTPNQHGIVEFLFDLDVLAEWLSRPEQVAA----VVISPDHMHLGE---YTEFTRLTKEADVPVIADEV--VGLRYRAG-------LSTPLLDPAVWIVAKCLANGS-AAVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATG-EPQQAIRAAGDRFIAHTRAAGVPILAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAAL.... 388
31 -19.3003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  29...................................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNI-DYDEMAKLAKEHKP----KMIIGGFSAYSGV----DWAKMREIADSIGAYLFVDMAHVAGLIAAG-----VYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAGFKEAEVKELAGWMCDVLDN..... 395
32 -19.2003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  16  24..........................................DIASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG--DFRIAGFPERY---EGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAESNALELVRRHENV-----VVTRTLSKSLAGMRIGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDRD-GKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE...... 353
33 -19.2004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  17  30...................................................QEDHIELIASENYTSPAVMAANKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNV-DYDAAEKLANEHKP----KLIVAGASAFALK----DFERLAKIAKSVGAYLMVDMAHYAGLIAAG-----VYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEKEYQQKVVENARVLAETLVKRGLRIVSGRTEMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAGFGPAEAEQVGNLIADVLEN..... 393
34 -19.2003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  17  25...................................................QNSNIELIASENFVSEAVMEANKYAEGYPGRRYYGGCEVTESIAIDRAKALFGAEHVNV--SGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYN--NYDEVRKLALEHKP----KLIVAGASAYSRT----DFKKFKEIADEVNAKLMVDMAHIAGLVAAG-----LHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNKTYQQQVVKNAKVLAEALINEGFRIVSGGTDAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKTSGIRLGTPAGFDEKAFEEVAKIISLALKN..... 390
35 -19.2006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  15  25..............................FTAASGAWLTDESGFRWIDFDNA-LLG--GDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPERVAA----VVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMANGH-SAVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVATG-EPQRAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL.... 371
36 -19.1003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  13  16............................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLD--DIEGLKAAVAAYSGPSIVYLVN---NPTGTITPADVIEPWIAS-NTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKAMAGMRVGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNF--VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI.. 354
37 -18.9006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  15  41..............................FTAASGAWLTDESGFRWIDFDNA-LLG--GDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPERVAA----VVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMANGH-SAVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVATG-EPQRAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL.... 387
38 -18.9004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  15  2...QSMSAFSRFTPLIQSLPASVPFVGPEALERQHG--------KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPEN---------HDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADREDLEGLLAAVGRENAPLVYLANPD--NPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKALAGARIGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASRAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA... 374
39 -18.8003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  11  22.............................................................PRNVGVLTEALQNIDDNLESD--IYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEE---ICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFE---KRIGKMAEYFEAAKGLAERFNSCSTVPEVPVSNMFHVYFENSADEIGLTKIQDETGVGISGYLQEKS-ADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL.... 359
40 -18.7001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  17  26...................................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEIVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNI-DYADLEKQAKEHKP----KMIIGGFSAYSGV----DWAKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRVGTPAGFKEAEAKELAGWMCDVLDS..... 392
41 -18.6004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  17  23............................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTDLYAMLATVTD---RTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKALAGLRIGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSR--TQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSD..... 353
42 -18.6001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  13  9............................................HQFPGLANKTYFNFGGQGILPTVALEAITAMENGPFSIAANQHIQQLIAQLRQALAETFNVDPTITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIFGITYRFFPVAATLNQAAAVLANHLGP------KTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGRVLVDGAQSAGSLPLDFSRL--------EVDYYAFTGHKWFAGPAGGGLYIHGDCLGEIAEGGKRFEVATSAYPQYAGAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDC------IRACCHYITDEEEINHLLARLADFG....... 389
43 -18.5004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  26...................................................QSSVIELIASENFVSPAVLEANKYAEGYPSKRFYNGCEKAENLAIERVKKLFNCKYANV--SGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNLIDYDEIERLADLHKP----KLLIAGFSAYPRN----DFAKFREIVDKVGAYFMADIAHIAGLVATG-----EHQSPIPYAHAVTSTTHKTLRGPRGGLISNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEKSYIQQVISNAKALASSLQERGYDILTGGTDVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSTSGIRLGTPAGFKEKDFVLVGHMVADILDG..... 391
44 -18.5005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  11  51.....................................................NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPETVVFVANATMGVNTVLR-ADGKDEILYFDTIYGACGKTIDYVIEDKRG-DDDVVAAFRDAIKKSREEGKRPRLAVIDVVSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITET--------DPDFLISNCHKWLFTPRGAVFYVPVRNQHLIRAFVSNFEFVGTVDNSPFFCVKDAIKWREEVLGGEERIMEYMTKLAREGGQKGTRVLENSTG-LPFVVGEDEEANMAFKWMYNVLQDEFNTFVPMTFRRRFWARLSAQVYLEMSDFEWAGKTLKELCERVA... 472
45 -18.5003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  13  29.AQRAGTIDVQRNENFGKLRAGYLFP---EIARRRKAHQEKNPDAKIISLGIGD--TEPLPKYIADAMAKAAAGLATREGYSGYEQGQGALREAVASTFYGHAGRADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNSKAKRTDIIFFCSPNNPTGAAATLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKGFTGVRLGWTVVPKALKYANGEPVHADWCFNGASNIVQAGGLACLQ-LKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFG--SRENILEAVRRFKEAYGKRN... 441
46 -18.5002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  17  22...................................................QREGLELIASENFVSKQVREANKYAEGYPGARYYGGCERVESLAIERAKALFGAAWANV--SGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYK--DLEEVRRLALEHRP----KVIVAGASAYPRF----DFKAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLRGPRGGLISNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEKEYSRLVVENAKRLAEELARRGYRIVTGGTLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPTSGIRIGTPAGFTPEEMPLVAELIDRALLE..... 387
47 -18.5003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  13  27............................................NVDIRLNTNE---YPPSEALVADLVATVDKIATELN--------ERDAVELRDELAAYITKQDNLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYA-----SPSPSATTLLEKYPTKLVVSRTMSKAFAGGRLGYFVANPAFIDAVMLVRLPY----HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNF--VFFGDFSDQHAAWQAFLDRGVLIRDVGIAG-------LRTTIG---VPEENDAFLDAAAEIIKL..... 364
48 -18.4005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  15  25...................................................QNEHLEMIASENYTFPSVMEANKYAEGYPNKRYYGGCEKIESLAIERAKKLFNCQFANV--SGSQANNAVYHALLKPYDKILGSCGGHLTHGAKVSLTGKHYQSFSYGDYEEALKIAQSVKP----EIIVCGFSAYPRE---IDFKKFREIADEVGALLLGDIAHVAGLVVTN-----EHAHPFPHCHVVSSTTHKTLRGPRGGIILTNEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSTSGIRIGSAAGMGAKEFEIIGNKISDILND..... 389
49 -18.4003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  13  24...................................................QCEGLEMIASENFTLPEVMEVNKYAEGYPGKRYYGGCEEIETLAIERCKKLFNCKFANV--SGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYES-DYEKVREIAKKEKP----KLIVCGASAYARV----DFAKFREIADEIGAYLFADIAHIAGLVVAG------HPSPFPYAHVVSSTTHKTLRGPRGGIITNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEKVYAKQVRTNAQVLANVLMDRKFKLVSDGHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSTSGLRLGTPAGFKEKEMEIVSNYIADILDD..... 388
50 -18.4003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  15  30............................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITLDEFKKLYETHKD---EIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLLGGLRIGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDEKN-STDLSEKLLKKGIIIRNLKSYGLN-----IRITIG---TSYENEKFFTEFDKILR...... 365
51 -18.4003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  16  31...................................................QQSQVELIASENIVSRAVLDANKYAEGYPGKRYYGGCEEVEALAIERVKRLFNAGHANV--SGAQANGAVMLALAKPGDTVLGDAGGHLTHGAKPALSGKWFNALQYGDYDQVEALAQQHKP----SLIIAGFSAYPRK----DFARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLRGPRGGFVTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDKTYIDRVLANAQALGDVLKAGGVDLVTGGTDLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKTSGIRLGTPAGFGAAEFREVGRLILEVFEA..... 396
52 -18.4006MME Entity 1(prereleased)  ali follow..  12  25............................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIA--YICLAVTVNLAGSMANMRAVRELTEAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDIR 435
53 -18.2004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  15  32............................................AVPVRLNTNE---HPPTRALVDDVVRSVRE-----AAIDLHRYPDRDAVALRADLAGYLTAQTGIWAANGSNEILQQLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDFGLDVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYG-----SSQPSAVSLVEEYPSKLVVTRTMSKAFAGGRLGYLIATPAVIDAMLLVRLPY----HLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANF--VLFGEFADAPAAWRRYLEAGILIRDVGIPGY------LRATTG---LAEENDAFLRASARIATDL.... 370
54 -18.2002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  14  16.EKIEYKTKVSRNSNMSKLQAGYLFP---EIARRRSAHLLKYPDAQVISLGIGD--TEPIPEVITSAMAKKAHELSTIEGYSGYEQGAKPLRAAIAKTFYGGLGIGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFRTDIIFFCSPNNPTGAAATLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVA-METASFSKGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFG--HRENILEACRRFKQLYK...... 426
55 -18.1004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  16  32...................................................QQNNIELIASENVVSKAVMAANKYAEGYPGKRYYGGTAVVETLAIERAKKLFGAKFANV--SGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYN--DYDAILAQAKEVRP----KLIVAGASAYSRI---IDFAKFREIADAVGAYLMVDMAHIAGLVASG-----HHPSPVPYAHVTTTTTHKTLRGPRGGLITDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAKEYGENVIKNAAAMADVFNQHPDFRVISNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSTSGIRVGSPAGMGEAESRQIAEWMVEALEN..... 398
56 -17.9003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  12  16...........................FADLQKRVAQFRLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCL----ENAFFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKGFAGIRLGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--LPQLEAIHYYRENSDLLRKALLATGFEVFGGEHALWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLG--KREDILAACERLQMAPALQS... 394
57 -17.9001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  13  20.TEVPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQ--IG--SHPALVKLVQQPQNVSTFINRPALGILPPENFVEKLRESLLSVAGMSQLITMACGSCSNENAFKTICPDYSILSFMGAFHGRTMGCLATTHSKAIH-EARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHAFRKLRDISRKHGCAFLVDEVQT---GGSTGK-AHEHWGLDDPADVM--TFSKKMMT--GGFFHKEEFRPNAPYRIFNTW----LGDPSKNLLLAEVINIIKRE-DLLSNAAHAGKVLLTGLLDLQISRVRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGC-------GDKSIRFRPTLVFRDHHAHLFLNIFSDILADFK... 472
58 -17.9004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  15  12.DGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGLSQG--CHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIAPDSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALKDPNVAA-----FFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSAGV-SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLKDE-KLADRAERLGAQFRDCLRRELYGKVPWIKEI--LLNADAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV.... 420
59 -17.9006DK6 Entity 1(prereleased)  ali follow..  12  1...MALINENFLKLKAGYLFPEIARRVKAFTEGNPEA------AQRLIRCGIGD--TEALPEAVRYAMHEAVDELGNRSTFKGYEQGYDFLRNAIADNDYKARGLPDEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYLKCTPENGQEKADLIYLCYPNNPTGAVATLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKGFTGVRCAYVVIPKSLMGRKKNGEAQALHPNGASYIVQKGAEALYT--SQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPY-VGCPAGLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFN--SRANVEEVCRRIAAL........ 410
60 -17.8005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  16  65.............................EWQAGSLNTLVDTQGQEFIDCLGG--VG--RNPVVVSAVQNQLAKQPLHSQE------LDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLA-GKFTFIATSGAFHGKSLGALSATAKSTFRVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPLTAVRKLCDEFGALMILDEVQT---MGRTGK-ACEHENVQPDI-----CLAKALGGGV-GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ-NLPAQAEQKGDMLLDGFRQL-VQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVA-----GTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAM.... 450
61 -17.8001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  14  41.........DDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSVNQG--CHPKIVNALKSQVDKLTLTSRA------YNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLAKYKAKIVFAAGNFWGRTLSAISSSTDPTSYIPYNDLPALERALQDPNVAA-----FMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQT---LARTGR-AVDYENVRPDI-----LLGKALSGGL-SAVLCDDDIMLTIKPGEHGSTYGGN--PLGCRVAIAALEVLEEEIILRNELMKLPSDVVTAVRGKGLLNA------IVIKETKDWDAWKVCLRLRDNGLLA-------KPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF.... 439
62 -17.8004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  16  26.........AESLDGIKSVIAGGVSSSMRAAAVPLPLVVRSAGGCLLRDVEDGEIIDLNADREVLDAVADQFAK-GHMTGLP------HELDARAGALIAELVPGVEQVRFNSGTEAVASALRATTGRTLVVTFEGHYHGW-SETVLRAGAHTVQLGWNDPDALRELFARDGDR----AAVIVEPVLANAGVIPPLQLLRELTGRSGAMLVFDEV--TGFRVARG-GAQERYGVEPDL----TVLSKVMGGGF-AAFGGRRHAMRMLASNEAHHAGVYAGNHAALRAVVAMLGKIRSLPDLYERLEDTGQYMEDTVREV-MSVALLKGSAEPAALVDFPRHRRLQTLAQKEGVYFHP---------NALEPWFLSTAHTRDVIDKVAGALQRSLVGLG... 458
63 -17.8003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  14  16............................................AQAVCLAFNE---EAVEPRVQAAIAAAAARINRYPFDAE---------PRVMRKLAEHFSCPDNLMLVRGIDECFDRISAEFSSMRFVTAWGYRARIAVSGLRHFEIGLTDDLLLDPNDL--------AQVSRDDCVVLANPSNPTGQALSAGELDQLRQR--GKLLIDETY-VDYSSFRARGLAYGENE-----LVFRSFSKSLAGLRLGALFGPSELIAAMKRKQWFC----NVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENAAGE---RTLRFLRERGIQVKDAGQFGLHH----IRISIG---REEDNDRLLAALAEYSDH..... 336
64 -17.8004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  16  67.............................EWQAGSLNTLVDTQGQEFIDCLGGFNVG--RNPVVVSAVQNQLAKQPLHSQE------LDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLA-GKFTFIATSGAFHGKSLGALSATAKSTFRVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPLTAVRKLCDEFGALMILDEVQT---MGRTGK-ACEHENVQPDI-----CLAKALGGGV-GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ-NLPAQAEQKGDMLLDGFRQL-VQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVA-----GTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAM.... 452
65 -17.7004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  15  27.DGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGLSQG--CHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIA-DSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALKDPNVAA-----FFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSAGV-SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLKDE-KLADRAERLGAQFRDCLRRELYGKVPWIKEI--LLNADAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV.... 435
66 -17.7005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  17  27...................................................QEAHIELIASENYCSPAVMEANKYAEGYPGKRYYGGCEVIEQMAIDRAKELFGADYANV--AGSQANSAVYLALLNPGDTVLGAHGGHLTHGAKVSFSGKTYNAVQYGDYEEVERLALEHKP----RMIVAGFSAYSRV---VDWQRFRDIADKVGAYLFVDMAHVAGLVAAG-----VYPNPVQIADVTTTTTHKTLRGPRSGLILAKANIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDKAYQQQVVKNAQAMAEVFIARGYDVVSGGHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSTSGIRIGTPAGFGEAEVRELAGWIADVIDS..... 393
67 -17.5001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  17  3...................................................RNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLGARMVEMAGLMGIAHHAYDCGEVARPDVQAIDAILNADPT-----SHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGI-------------ALHIDYLISSANKCIQGVPGAFVIAREQKLAACKGHSRSLSLDLTSPTHTVLAFAQALKELAKEAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITDPQYRFSEFYRRLKEQGFVI----YPGKVSQSDCFRIGNIGEVYAADITALLTAIRTAMYWTK... 366
68 -17.5004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  11  30.KKLGGSTKLVRNVNLEKLKNNYLFP---EINRRELEHIEKHPNVQLISLGTGD--TEPIPEQITSHMSNFAHGLSTVEGYRGYEQGNKTLRKAIAETFYRDLHVKNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPCGPNNSFRTDVIFFCSPNNPTGYVASLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVA-IEVSSFSKGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSSGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGSKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFG--RRDHIVEASKRLQNFFNTR.... 442
69 -17.5006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  12  9.....VPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAH------------SASQQSIVSRLPQLWYE-----------GLQATYEKRFTEAFFQLHRQNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDRIYPELERRVRTDALFLVDGFSLLRHGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYELLENSGLAIEDTGKTWPDAKCALITASDDIWETVYNLHTSVLLNV--SPFVLNMLTQYVRDSAADASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFHPELTATDVHRLLSADGVYVLPFYWSEPSKGDAYVRMALAR--EPEMFADAMALTRQVLDRHG... 406
70 -17.4005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  16  2.AMSETKNSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAVNQG--SHPKIVEALVEQASKLALTSRA------YNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLAENAAKIIVCENNFHGRTTTIVSFSNDPDANIPYNDIAALEEVLSKEAGNIAA---FLVEPIQGEAGVYVPLKQSSELCKKHNVLFIADEVQT---IARTGK-ACHHEDVQPDI-----ILGKALSGGM-SAVLANNNIMDVIKPGQHGSTFGGN--PLACAVAMAALDVVQDE-KLSERAEKLGNLFRSEIEKL-----IEKTDLITKVRGDSSTAWNLCLALKENGLLA-------KPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF.... 413
71 -17.4002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  10  5SSGLVPRGSHMISNKLANIPDSYFGKTM--------GRKIEHGPLPLINMAVGI--DGPTPQGIIDHFQKALTIPENQKYGA--FHGKEAFKQAIVDFYQRQYNVTEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVA-IEIYSLSKNMSGFRVGFAVGNKDMIQALK-KYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLTPPGYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLAL--DDQKLDEAAIRLTELAYLYE... 398
72 -17.4002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  17  32.....................................................DLSGLSGGFLIDEKDKALLNTY---------IGSSYFAEKVNEYGLKHLGGNDKCVGFNRTSSAILATILALKPKKVIHLPELPGHPSIERSCKIVNAKYF--ESDKVGEILNKIDKDT-----LVIITGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKLG----ADLVVTSTDKLMEGPRGGLLAGKKELVDKIY--IEGTKFGLEAQPPLLAGIYRALKNFNLERIRKA.................................................................................................. 262
73 -17.4004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  13  25...................................................QRETINLIASENLTNGAVRECNKYSEGYPKKRYYGGNDKIEELCQKRALEAFNVSDEEWGVSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDDLDAVREMALSF-----KPKVIICGY--TSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACN-----ILNNPFLHADVVTTTTHKILRGPRSALIFFNKKIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAKEYTQQVLLNSKALAKALISKQIDLVTNGTDIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDVDSPSGVRIGTPAGAKEKDMEFIADVLARAIK...... 399
74 -17.3006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  16  51...................................................QCRGLELIASENFCSRAALEANKYSEGYPGKRYYGGAEEIELLCQRRALEAFDLDPAQWGVSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIDYNQLALTARLFRP----RLIIAGTSAYARL----DYARMREVCDEVKAHLLADMAHISGLVAAK-----VIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMREYSLQVLKNARAMADALLERGYSLVSGGTDVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSTPGGLRLGAPAQFREDDFRRVVDFIDEG........ 435
75 -17.3002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  19  38..............................LVRGEGAYVWDADGNRYLDYVMS-ILG--AHPKVLARVRETLER-GLTFGAP------SPLEVALAKKVKRAYPFVDLVRFNSGTEATMSALRGYTGRPYIVKFRGNYHGH-ADGLLVEAGSTLVLEYNDPEGLREVLKRRGEE----AAIIFEPVVGNAGVLVPTEDFLKEAKAYGVLLIADEV--TGFRLAFG-GATELLGLKPDL----VTLGKILGGGL-AAYAGRREIMEKVAPLGPVYQAGTSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEV-ITVFFTEGPVVDARRTDTELFKRFFHGLLDRGIYWPP---------SNFEAAFLSVAHREEDVEKTLEALRKA........ 423

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.