current user: public

If you have questions about the server, please let us know.

Query: 1kkj_A mol:protein length:419 Serine Hydroxymethyltransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MKYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGSEQALEEARQRVAALTDPTSRSAAGTMEFEALast
1 -121.0001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model  100  1MKYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGSEQALEEARQRVAALTDPTSRSAAGTMEFEA 419
2 -115.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  71  4MSYITKQDKVIAEAIEREFQRQNSNIELIASENFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTESIAIDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYNFVEYGVDKDTERINYDEVRKLALEHKPKLIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVKGSILTGKEAEETLDSVGITCNKNTIPFDQEKPFVTSGIRLGTPAATTRGFDEKAFEEVAKIISLALKNSKDEEKLQQAKERVAKLTAEYPLYQ........ 415
3 -114.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  60  9QSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR........ 418
4 -113.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  56  18.APLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKVSGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALATGSSVD-VSALKDRATRLARAFPLYD........ 431
5 -113.0005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  58  7.ISISEFDPELAQAIASEDERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEFVDVIEQMAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQYGLNAETGEIDYEEVERLALEHKPRMIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKANEEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVVSGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGDEKVIADVKAKVEAVCAKFPVYA........ 418
6 -113.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  59  6.MNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGID-ATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARYPVYA........ 417
7 -112.0003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  59  11.QSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSRDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTHATEQRVRREIFALCERFPIY......... 425
8 -112.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  56  6.NNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDEEIHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNSALEQQVLNEVTKLIELFPFYG........ 420
9 -112.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  59  12.EDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVSGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY......... 422
10 -112.0005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  53  5.YFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVN-LDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTNEHAHPFPHCHVVSSTTHKTLRGPRGGIILTNDEEIAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINNVSLQLHVKEELKAMANQFPVYQQ....... 415
11 -111.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  65  1MVSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPS----EALREEVRRLALAHPM.......... 406
12 -111.0003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  54  4.MSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFY-GVELDGRIDYEKVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRGGIIMTNDEELKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNNEKLQENIKQELKKLASNFIIYE........ 413
13 -109.0004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  57  6.MNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITPETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKANEEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDETTITAVKVKVAALCKACPVYGL....... 422
14 -109.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  58  9.MNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGID-ESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEATIERVKAKVLDICARFPVYA........ 420
15 -108.0005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  46  25QESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVTSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSLANLRQRVEQFARAFPMPGF....... 480
16 -107.0005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  44  16.GHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTSAVSTYFETMPYRVDLETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYKLVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGDR-SALVPGGVRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKSDEITQLKNEISAWAGEFPL.......... 468
17 -107.0001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  46  18.QPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEMLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKIFFESMPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYKIVTGGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELTLQIQSVATLREEVENFASNFSLPGL....... 475
18 -106.0006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  45  14.QPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTSATSIFFNSMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQAL 454
19 -105.0004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  34  2..EYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLEGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALA-EMLEFGEAYAKQVIKNAKALAQALYERGFNVLCDFTESHQVIIDIEDIEFSASELAKMYEEANIILNKNLLPWDDNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEK---PEKVREDVKEFAKEYSTIHYSFDEGDG 422
20 -105.0001bj4_A mol:protein length:470 PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)  ali model follow..  46  14.QPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSVQALREEVESFASLFPLPGL....... 470
21 -103.0006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  49  7.YGLSEADPDVHAIINKEKDRQFRSLELIASENFTSKAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELEILCQQRALAAFDKWGVNVQPLSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMTSGTSIYFESMPYRLDESTGVIDYDMLEKTAALFRPKLIIAGASAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAASVLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDAVSAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLVSGGSDNHLVLVDLRPSGIDGARVEKILDMASITLNKNSVPGDK-SALVPGGIRIGSPAMTTRGLGEKEFELIADLIHEGVRISLEGDKVSNLRRKVEALATQYPI.......... 452
22 -103.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  46  31.ESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSSATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSLANLRQRVEQFARAFPMPGF....... 485
23 -102.0004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  40  37.DPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDLFESCNSEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILRGPRSALIFFNKKIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLVTNGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDV-DCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILLTDENPKIDELKKEVVQWAKNLPF.......... 473
24 -102.0004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  39  5.EPLEQIDKELHDILADEEKRQRETINLIASENLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDFIDKIEELCQKRALEAFNVSGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDMFESCNSQGYVDLDAVREMALSFKPKVIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACNILNNPFLHADVVTTTTHKILRGPRSALIFFNKKIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQIDLVTNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDV-DCVSPSGVRIGTPAMTTRGAKEKDMEFIADVLARAIKITVDLQELQQLKQEVVTWAGALPF.......... 441
25 -100.0001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  46  23.QPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEHIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQQRAVRALRQEVESFAALFPLPGL....... 480
26 -20.7003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  18  21.AGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGPALIKTAQTVV-EQYGFGMASVRFICGTQ---TIHKELEKDISEFLGTDDTIL---SCFDANGGLFETLLGPEDAIISDELN---HASIIDGIRLCKAQRYRYKNN--------AMGDLEAKLKEARFKLIATDGSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENEYCGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHP---IIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMG---KARIRVQMSAV-----TQQQLDRAIEAFGQVGKK................................. 395
27 -20.7002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  15  54....................................................................PIHDFIHNQLPKFLGCDVARV---GAREAKFAVMHSLAKKDAWVV---MDENCHYSSYVAAERAGLNIALVPKTDYPD-YAITPENFAQTIEETKKRLITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE----GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEE-VEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEV-GGRFFLYRELKSRKIHGIKPGLT--------------RYFKLSTYGLSDEEVDYVLNAFKEIIEK................................. 369
28 -20.5005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  38...........YKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRL---DEVTCPPIKDFLEDIAKFLNMDCARP-THGAREGKFIVMHAICKEGDYVVLDKNA---HYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNKNVGLILLTDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE----KADFIVASGHKSMAASAPGILAFSEEFSDKITKPVKEIEMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPV----DEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKEI---KMSVYGLEWEQVEYVVNAIKEIVE.................................. 408
29 -19.9001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  17  52.....................ANNYLGLANHPDLIAAAKAGM------DSHGFGMASVRFICGTQ---DSHKELEQKLAAFLGMEDAIL---SCFDANGGLFETLLGAEDAIISDALN---HASIIDGVRLCKAKRYRYANN--------DMQELEARLKEAREHVLIATDGVFSMD-NLKGVCDLADKYDALVMVDDSHAVGFVGENEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGADHA---IIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKG---QARIRTQMSA----AHTPEQITRAVEAFTRIGKQ................................. 396
30 -19.8002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  16  46.....................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY................................. 383
31 -19.8002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  19  10............................LRSDTVTKP------TEEMRKAMAQAEVGDDVYGEDPTINELE----RLAAETFGKEAA-LFVPSGTMGNQVSIMAHTQRGDEVIL---EADSHIFWYEVGAMAVLS--VMPHPVPGKNGAMDPDDVRKAIRPPRTSLIAIENTRVVPLENIKEICTIAKEHGINVHIDGARIFNASIA-PVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKE------ENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANA----------VSDTEIRL----VTHKDVSRNDIEEALNIFEKLFRK................................. 347
32 -19.6001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  17  46.....................SNDYLGLSHHPQIIRAWQQGA------EQFGIGSGGSGHVSGYS---VVHQALEEELAEWLGYSRALL---SGFAANQAVIAAMMAKEDRIAADRLS---HASLLEAASLSPSQLRRFAHN--------DVTHLARLLASPCPGQMVVTEGVFSMD-PLAEIQQVTQQHNGWLMVDDAHGTGVIGRGSCWLQKVKPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDGDARREKLAALITRFRAGVQDLPFTLADSCSA---IQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAG---TARLRLTLTA----AHEMQDIDRLLEVLHGN.................................... 383
33 -19.5003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  16  60.....................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY................................. 397
34 -19.5002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  18  51.....................TYNYMGMTFDPDVIAAGKQAL------DEFGSGTTGSRVLNGTY---QGHKACEDALKEFYGTEHAIV---TGYQANLGMISTLAGKGDYIIL---DADSHASIYDGCWLGDAEIVRFRHN--------SVEDLDKRLGRLPAKLVVLEGSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHEEAGVEADVDFVVGTFSKSV-GTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHA-GDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTDMA-QAVALWQGLLEAGLYVNTARPPATPAG---MFLLRCSLCAE-----SDEQVEQILGMFESAGRA................................. 394
35 -19.4003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  19  50.....................SNSYLGLTTDTRIIKAAQDAL------EKYGTGCAGSRFLNGTL---DIHVELEEKLSAYVGKEAAIL---TGFQSNLGPLSCLMGRNDYILL---DERDHASIIDGSRLSFSKVIKYGHN--------NMEDLRAKLSRLPEKLICTDGSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKSHFGLNDDVDLIMGTFSKSL-ASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDLGATESP---ILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAE---ESLIRFSLMAT-----TYDQIDEAIEKMVKVFKQ................................. 391
36 -19.2004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  15  52.....................TSDYLNLSSAHNLKHAIVNGF------DKYGFGSKGSNIVCGYT---DETQQFEHEFAKFINYPRAIF---SGFMANLAIYSTLFSKHDSIFADKYI---HASIIDGIKLSQAKLRRYKHQ--------QLSQLQDIYDGKS---FITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLAINSFRISYKNCLICVFPLGKAF-GGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV-NDNRARLQQNITFFNELCDAKDLELV--SKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKD---QAILRFSLHSN-----TFDQIQQALEIISKEVKY................................. 387
37 -19.2003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  5.EARRAHEHLIRLLLEQGKCPEDG------DESTLELFLHELAVMDSNNFLGNCGVGER--AGSSLLNKITNSLVLKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPECLHSTTACFA---RLEELAVICANYDIPHVVNNAY--GLQSSKCMHLIVGRIDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNA----AAAIGMKMQDVDLFIKRLDKCLNIVRKEQ............................ 447
38 -19.1001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  13  46......DELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLHPYQDPRTAQGALRLMWEL-GEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHED--VVLVPDSAHGSNPATASMAGYQVREIPS---GPEGEVDLEALKRELGPHVAALMLTNPNTLLFERRILEISRLCKEAGVQLYYDGANLNAIMG---WARPGDGFDVVHLNLHKTF-GPGSGPVGVKAHLAPYL-KSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQ------PPEGFRALDLAKGLLELGFHPPTVYFPLIVKEALMVEPTETE----AKETLEAFAEAMGALLKKPKEWLENAPYSTPVRRL................ 457
39 -19.1005i90_A mol:protein length:427 PvdN  ali model follow..  15  30.EGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRNPGEAVDWHREEIWKYEDE-ARAWAGRYFAVQPGQV-TGSTTDGLAAIYGGLVQPGKEILTSSHEHYSTYTLEYRHKRMGTQVREFPLFKDPHRVSADLSSIAAQIRP-QTRVLGMTQSGSGVKLPIREIGKLVRELNQIYVVDGVHGFGVEDVSFAD----DCDYFIAGTHKWLFGPRGGVIIARSEQLQEHLVPSIPTFSGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEPKVRLVTTSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVD---------VGPVVRLAPSLLN----DEAEIDRVLEILAPQL................................... 426
40 -19.1002hzp_A mol:protein length:501 Kynureninase  ali model follow..  12  69LRHFREKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESI-VGLMKDIVGANEKEIALMNALTVNLHLLMLSFPKRYKILLEAKAFSDHYAIESQLQLHGLNIEESMRMIEETLRIEDILEVIEKEGD-SIAVILFSGVHFYQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD----GVDFACWCSYKYLNAGAGAGAFIHEKHAHTIKPALV---ISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKR----------NPNGIRVAPVPLYN---SFHDVYKFTNLLTSILDSAETKN............................ 495
41 -19.0002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  18  71.....................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN--------SVEDLDKRLGRLPKKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSKSV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQE-QAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICAE-----TPAQIQTVLGMFQAAGRA................................. 414
42 -18.8005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  13  7................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS----EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVIC---SETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE--DGAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQM------PEHAIEALRAKGWRFYTFI---------GSGGARF----MCSWDTEEERVRELAADIRSIITA................................. 346
43 -18.8001v72_A mol:protein length:356 Aldolase  ali model follow..  14  11................................GFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVK----RKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWGNIYC---HPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKQPACVSITQATIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVS-AEMTWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLT--DDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSAMIDALLKAGF-----------------HDRWGPNVVRF----VTSFATTAEDVDHLLNQVRLAADRTQER............................. 356
44 -18.7004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  18  87.....................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN--------SVEDLDKRLGRLPAKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSASV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQE-QAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICAE-----TPAQIQTVLGMFQAAGRA................................. 430
45 -18.7001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  15  14VEKIRVPSREEREAALKEAGY--NPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLK----DKAKELFNYDYI-IPAHQGRGAENILFPVLLKYKQKEGKFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKGDFDIKKLKENIAQHGADNIVAAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEIFTLARQRCVPMEGFVTYGGLAGMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQ-YPTGGHAVFVDCKKLVPQ-AVINALYLESGVRAVEIGSFLLGRDPATGE-MRLTIAR-----YTNDHMDYIADALIGLKEKFATLKGLEFEYEPLRHFTARLKPIE........ 467
46 -18.7005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  16  48.....................SNDYLGLAAHPQLIAAIAEGA------QRYGAGSGGSHLLGGHS---RAHAQLEDDLAEFVGGFVENARALTGYMANLATLTALAGRGTTLFSDALN---HASLIDGARLSRADVQIYPHC--------DTDALSAMLEASDADKVIVSDTVFSMDAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTA---VQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTG---TSRLRISLSA----AHSQADLDRLEAGLQQLGAK................................. 394
47 -18.6001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  15  34.......................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTAAHGIKVFYDATRCVENAYAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLRE-YEYIEHRVKQVRYLGDKLKAAGVPIV-EPVGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRLTIPR-----YTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPLRFFTARFDYI......... 456
48 -18.6005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  14  1MNLLDTLQRGLADLDAQGLRRVRRTADGFASNDYLGLAAHPKLFAEGAQRYGSGSGGSHLLGGHS---RAHAKLEDELAGFAGGFSDAPRALTGYMANLAAVTALAGKDATIFSDALN---HASLIDGTRLSRATVQVYPHA--------DTATLGALLEACTSQKLIVTDTVFSMD-PLAELLALAERHGAWLVVDDAHGFGVLGPQAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDGDARRAHLAALIERTRALLRRTRWQPVDSHTA---VQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAG---TSRLRISLSA----AHSFDDLARLETALLRASEE................................. 392
49 -18.6003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  17  4............................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRERNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQE------DNAAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSREQLAEVAAHWRAFLAR................................. 333
50 -18.5002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  66LKFLSMMDTDKDPKSVRIGEREARTYSKIHEELSSGFCHGIGRSGNLV-------DPQPKASGASIMYALTNKILESFFKQLGLHAIATPISTGMSISLCLSAARKKYGSNVVIYPYA--SHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEIELCVLSTLTFFPP--DIVEIAKICENYDIPHIINGAY--AIQNNYYLEK-KYRVDAVVSSSDKNLLTPIGGLVYSTDAEFIKEISLSYPGRASA---TPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDY---IVMNAAIGVRTEDIVNSVSKLEKIL................................... 449
51 -18.4001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  12  17................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAA----RLIGELLERPDADV-ISGGTQTNLIACSLALRPWEAVIA---TQLGHISTHETGAIEATGHKVVTAP--CPDGKLRVADIESALHENIPKLVYISNTTQYTKQELEDISASCKEHGLYLFLDGARLASALSS-TLADIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK--DNLFFELGAHSNKMAAILKAGLEACGIRLAWP-SASNQLFPILENTMIA--ELNNDFDMYTVEPLKDG----------TCIMRL----CTSWATEEKECHRFVEVLKRLVASTA............................... 359
52 -18.2004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  4............................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQE------DNTAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINA------------SPIVRL----VTHLDVSRAQLAEVAAHWRAFLAR................................. 333
53 -18.1006MME Entity 1(prereleased)  ali follow..  14  34.......................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTEAHGIKVFYDATRCVNKSIAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLRE-YEYIEHRVKQVRYLGDKLKAAGVPIV-EPVGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRLTIPR-----YTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPLRFFTARFDYI......... 456
54 -17.8001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  15  8.LALDAQDS--LAPLRQQFALPEGVIYL-NSLGARPVAALARAQAVIAEEWGNGLIR--SWNSAGWRDLSERL-GNRLATLIGARDGEVVVTDTTSINLFKVLSAAPERRVIVTETSNFTDLYIAEGLADMLQQGYTL--------RLVDSPEELPQAIDQ-DTAVVMLTHVNYKYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ----GADYAIGCTYKYL-GPGSAFVWVSPQLCDLVPQPLS---CGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRELTLVTPREHAKRGSHVSFEHP-EGYAVIQALIDRGVIGDYR----------EPRIMRFGFTPLYT---TFTEVWDAVQILGEILDRKTWAQAQFQVRHSVT.................. 416
55 -17.8003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  15  9............................LRSDTVTQP------TDAMRQCMLHAEVGDDVYGEDPGVNALE----AYGADLLGKEAA-LFVPSGTMSNLLAVMSHCQRGEGAVL---GSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDTPTRLVCLENTVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVA-TVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHV----VRLADDHRRARQLAEGLAALGIRLDLAQVQTNMVFLQLTSGESA--PLLAFMKARGILFSG------------YGELRL----VTHLQIHDDDIEEVIDAFTEYLGA................................. 341
56 -17.8002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  13  1...MLSDYEEFLRLIILEILNEKGRDALYDLSGLSGGFLIDEKDKALLNTYI------------GSSYFAEKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYL-PELPGHPSIERSCKIVNAKYFESD----------KVGEILNKIDKDTLVIITGSTMDLIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKGADLVVTSTDKLMEGPRGGLLAGKKELVDKIYIEGTKFGLEAQPPL-----LAGIYRALKNFNLERIRKAFERAKNFDLSKIEKNINIVYERTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYIKAIVESIKMAFKS................................. 374
57 -17.7005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  17  33YRYFNNINRLAKEFPLAHRQREADKVTVWCSNDYLAPEVLDAMHKTI-DKYGCGAGGTRNIAGHN---IPTLNLEAELATLHKKEGALV---SCYVANDAVLSLLGQKMKDLVIFSDE--NHASMIVGIKHANVKKHIFKHN--------DLNELEQLLQSYPPKLIAFESSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGKGGAKTVMDRVDMITGTLGKSF-GSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCH-IDLRTSQQKHTMYVKKAFHELGIPVI--PNPSHIVPVLIGNADLAKQASDILINKHQIYVQAINFPTVARG---TERLRITPTP----GHTNDLSDILINAVDDVFNE................................. 429
58 -17.7002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  18  23FIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGPVVLAAMHEAL-EAVGAGSGGTRNISGTT---AYHRRLEAEIAGLHQKEAALV---SAYNANDATLSTLRVPGLIIYS---DSLNHASMIEGIKRNAGPKRIFRHN--------DVAHLRELIAAAAPKLIAFESSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRERDGLMHRIDIFNGTLAKAY-GVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAGQKLRDAQQMHAKVLKMRLKALGMPII--DHGSHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRG---TERLRFTPSPV-----DLKQIDGLVHAMDLLWAR................................. 399
59 -17.7003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  23.EARRSHEHLIRLLLEKGKCPENHELAIMDSNNFLGNCSALVARRHYRFIHGIGRSGD---AGSSLLNKITNSLVLKLAGVHTVANCFVVPMATGMSLTLCFLTLRPKAKYII---WPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCIHSTTSCFA---RLEELAVICANYDIPHIVNNAY--GVQSSKCMHLIQQRIDAFVQSLDKNFMVPVGGAIIFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKES........................ 469
60 -17.5004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  13  64.LSSSAVLEKLKEYSSMDAFWQEGRATVYSGEEKLTELLVKAYGDFAWSNPLH-------PDIFPGLRKIEAEIVRIACSLFNGDSCGCVTSGGTESILMACKAYFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPL---TKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDVPEVAKLAVKYKIPLHVDACL--GFLI--PFDFRVKGVTSISADTHKYGYAPKGSLVLYSDKKYRNYQFFVDTDWQGGIYASISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIGIFVFG---NPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP---------PSIHF---CITLLHARKRVAIQFLKDIRESVTQIMKNPKAKT-RNMVAELSSVFLDSLYSTDTVTQ 500
61 -17.5001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  12  101.NYEDSILPPFFKSLKEYVSRYLIQFDC-PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLI-AEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVL---FDRNNHKSYNSALAMAGGRPVYLQTNRNPYGFIYDSDFDEKKIRELAAKAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRN-EDPGIIVVQSVHKQQAGSQTSQIHKKDSHIKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAKWHAYEGYGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDAETPAKMNNLITQLLQLQRLI............ 566
62 -17.4002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  14  133.RYRQQLLPPLFSALMKYSDIHEYSWAA-PGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLD-SEKYAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---VDRNCHKSIEQGLMLTGAKPVYMVPSRNRYPQEMQPETLQKKISESKPSYCVVTNCTY---YNAKEAQDLLEKTSDRLHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGNFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR......................................................................................................................... 463
63 -17.3005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  12  30.......PLPFGNSLLKEFVLDPAYRNL----NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPVETVNATMGVNTVLRNIVWSADGKDEILYFDTIYGACIDYVIEDKRGIVSSRCIPLIYPAEDDDV-VAAFRDAIKKSRPRLAVIDSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITE----DPDFLISNCHKWLFTPRGAVFYVPVRNQHLIRSTLPTSHGFVPQVGNRVKDAIKWREEVLGGEERIMEYMTKLAREGGQKVAEIGTRVLENSTGTLIIALPFVVGEDPKAPVKLTEKEEKDVEGLYEIPHEEANMAFKW-ARLSAQVYL----EMSDFEWAGKTLKELCERVAKGEYKES........................ 479
64 -17.2001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  14  34.......................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMIGDEAYAGSENFYHLE----KTVKELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGFHQEKNGATFVDIVRDEAHDASLNLPFKGD-----IDLNKLATLIKEKNIAYICLAVTV-VSMANMRAVHEMASTYGIKIFYDATRCVNVSIKDIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLRE-YEYIEHRVKQVRYLGDKLREAGVPIV-EPTGGHAVFLDARRFCPHLTQDQRSMERGIVSAGRSKETGENHRPKLE--VRL---TIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLTFVYEPLRFFTARFDFI......... 456
65 -17.2003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  15  2MRNMQEKGVSEKEILEELKKYRSLDLKYEDGNGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTK---LLEEKAVALLGSLLNNKDAGHIVSGGTEANLMALRCIKNSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPI---KEDYTIDEKFVKDAVEDYDVDGIIAGTTELGTIDNIEELSKIAKENNIYIHVDAA-FGGLVIPFLDDKYKLGVDSITIDPHKMGHCPIPGGILFKDIGYKRYLDVDAPTILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPI-----LNIVAIEDEDYKEVCKKLRDRGIYVSVCNCV---------KALRIVVMPHIKREHIDNFIEILNSIKRD..................................... 397
66 -17.2003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  32MPENSIPKEAAYQIINDELMLDGN--LASFVTTWMEPECDKLIMSSINKNYVD-------MDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGSSEAIMLAGLAFKRKWQNKRKAEGVQVCWEKFARYFEVELKEVK--LSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEVKLLNDLLVEKNKETGWDT-HVDAASGGFIAP--LPLVKSINVSGHKYGLVYAGGWVIWRNKEDLPEELIFHINYLGADQPTQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSLKSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITV---LRVVIREDFSRTLAERLVIDIEKVMRELDELPSRVIHKISLGQEKSESNSDNLMVTVKKSDIDK 480
67 -17.0003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  12  80.LPRAEILAEIAAMGAAESPAWRD---VYHGDEHHIAFLNEVYALQSQSNPLH-------PDLWPSTAKFEAEVVAMTAHMLGGTVCGTVTSGGTESLLLAMKTRATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPL---DADYRADVAAMREAITPNTVVVAGSAPGYPHGVVDIPEIAALAAEHGIGCHVDACL--GFILVPPFDFRLEGVTSVSADTHKYGYGAKGSVILYRRPDLLHYQYFIAADWPGGLYFSLSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAISLKILGDPL----WVIAVASDELNIYQVMEEMAGRGWRLNGLHRP---------PAFHV---ALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKATGMAPVYGMAAAAP........... 494
68 -16.8005xx1_A mol:protein length:756 Arginine decarboxylase  ali model follow..  14  134.RYRQQLLPPLFNALMKYSDIHEYSWAA-PGHQGGVGFTKTPSGRFYHDYYGENLFRSDMGIERTTLGSLLD-SEKNAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---LDRNCHKSIEQGLILTGAKPVYMVPSRNRYPQEMQPETLQKKISASKPSYSVVTNCTY---YNAKEAQDLLAKTSDRIHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR......................................................................................................................... 464
69 -16.8002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  15  18......................PNKLLMGPGPSNAPQRVLDAMSRPILGHLH------------PETLKIMDDIKEGVRYLFQTNNIATFCLSGHGGMEATLCNLLEDGDVILIGHTGHWGD-RSADMATRYGADVRVVKSKVGQS---LSLDEIRDALLIHKPSVLFLGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLG---GAPMFMDRWEIDAMYTGSQKVLGAPPGTPVSFSHRAVERYKRRNTKVYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELADPKDRLSTVTTIKVPQGVDWLKAAQYAMK-----TYLVEISGGLGPTAGQVFRIGLMGQN---ATTERVDRVLQVFQEAVAA................................. 382
70 -16.7003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  13  1...........MDITQFSQLNPPSRLLMGPGPINADPRVLRAMSSQLIGQYDPAM------------THYMNEVMALYRGVFRTENRWTMLVTSRAGIEAILVSAIRPGDKVLVPVFGRFGH-LLCEIARRCRAEVHTIEVPWGEV---FTPDQVEDAVKRIRPRLLLTGDTSTTMLQPLAELGEICRRYDALFYTDATASLG---GNPLETDVWGLDAVSAGMQKCLGGPSGSPITLSARMEEAIRRRKCVEEGHTEATTALFGARECARLILQEGLDYGIARHKLHGDALVKGIQAMGLETFGDLKKMNNVLGVVIPQGINGDQARKLMLE-----DFGIEIGTSFGPLHGKVWRIGMGYNARKDCVMTTLSALEAVLNYLKFPTTQGAAMQAAWDHYRS................. 409
71 -16.7004j8l_A mol:protein length:361 Uncharacterized protein YhfS  ali model follow..  12  8........................SLTIIEAQQKQFALVDSICRHFPGSEFLTGGDLGLTPGLNQ--PRVTQRVEQVLADAFHAQAAALVQGAGTGAIRAGLAALLKPGQRLLVHDAPVYP--TTRVIIEQMGLTLITVDFN--------DLSALKQVVDEQQPDAALV-RQQPQDSYVLADVLATLRAAGVPALTDDNYAVMKV----ARIGCEGANVSTFSCFKLFGPEGVGAVVGDADVINRIRATLYSGSQIQGAQALEVLRGLVFAPVM-------HAVQAGVSERLLALLNGGAVSAVIANAQSKVLIVEFHQPIAAR-GAESKYEIPPLFYRLSGTFRQANPQSEHCAIRINP--------NRSGEETVLRILRESIAS................................. 360
72 -16.7004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  21......................PNQLLLGPGPSNLPPRIMAAGGLQMIGHMSKEM------------YQIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQ-RAVDIGERIGARVHPMTKDPGGH---YTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGSLISFSDKAKKKMYSRKTKPYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALPTVTTVAVPAGYDWRDIVSYVMD-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH................................. 386
73 -16.7002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  21......................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDM------------YQIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQ-RAVDIGERIGARVHPMTKDPGGH---YTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALPTVTTVAVPAGYDWRDIVSYVMD-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALVA................................. 386
74 -16.7005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  13  26......................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDM------------YQIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQ-RAVDIGERIGARVHPMTKDPGGH---YTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGSLISFSDKAKKKMYSRKTKPYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALPTVTTVAVPAGYDWRDIVSYVID-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH................................. 391
75 -16.7003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  14  1.............MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAF------------TGIMNETMEMLRELFQTKNRWAYPITSRAGIEAVLASVIEPEDDVLIPIYGRFGY-LLTEIAERYGANVHMLECEWGTV---FDPEDIIREIKKVKPKIVAMGETSTGRIHPLKAIGEACRTEDALFIVDAVATIG---GCEVKVDEWKIDAAIGGTQKCLSVPSGAPITYNERVADVIAARKKVERGHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLGDDSCKMPVVTCVEIPGGIDGESVRDMLLA-----QFGIEIASSFGPLAGKIWRIG-----TMGCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYEN............. 409

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.