current user: public

If you have questions about the server, please let us know.

Query: 1lk9_A mol:protein length:448 ALLIIN LYASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .
# Score Template Links and tools%idFirst KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFFNPVSNFISFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRHAVIKGCKSIYDMVYYWPHYTPIKYKADEDILLFTMSKFTGHSGSRFGWALIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTQKGTMRDLNTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFEASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRKTPLIKQLFIDQTETASRRPFILast
1 -132.0001lk9_A mol:protein length:448 ALLIIN LYASE  ali model  100  1KMTWTMKAAEEAEAVANINCSEHGRAFLDGIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFFNPVSNFISFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRHAVIKGCKSIYDMVYYWPHYTPIKYKADEDILLFTMSKFTGHSGSRFGWALIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTQKGTMRDLNTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFEASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRKTPLIKQLFIDQTETASRRPFI 448
2 -77.8003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  34  6.......................................NSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTCWFLEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLAR----SQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWG---FDKKGPYIELVTSPNNPDGTIRETVVNEAKVIHDFAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESES-ENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEA-FCNYFGKSLESYPAFAWLGT--KEETDLVSELRRHKVMSRAGERCGSDKKHVRVSMLSREDVFNVFLERLANMKLIKSID.................... 390
3 -65.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  14  1...........................MLSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSL------KEGKTHYTDSRGI-LELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSI--------IDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDFTVESLEEALSDKTKAIIINSPSNPLGEVIDAYENIPYIISDEIYNGLVYEEFDENLEKTILINGFSKLYAMTGWRIGYVISN-DEIIEAILKLQQNLFISAPTISQYAALKAFE----------KETEREINSMIKEFDRRRRLVLKYVKDFG---------------WEVNNPIGAYYVFPNIGEDGREFAYKLLKEKFVALTPGIGFGSGKNYIRISYANSYENIKEGLERIKEFLNK........................ 370
4 -62.9003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  13  5.............................NSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSL------ETDALGYTVALGL-PALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTAL--------FDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENPADFAGLDLAGLMVASPANPTGTMLDAQAQGASFISDEIYHGIEYETALELTDECYVINSFSKYFSMTGWRVGWMVVP-EDQVRVVERIAQNMFICAPHASQVAALAALDCDAE------------LQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVS-----------DLTDDSRAFAAEILEKAGVAVTPGLDFDPGAGTLRFSYARATADIEEGLDRLEAFMQARGE..................... 384
5 -62.2003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  10  9.......IRQFTNLMSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDIPMVNQ--YSPTRG----RPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGL--------LNAGDEVIVFEPFFDQYIPNIELCGTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTCVKHNVVIISDEVYEHLYFTDSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAELLSYAAKAHTRICFASPSPLQEACANSINDALK---------IGYFEKMRQEYINKFKIFTSIFDELG-LPYTAPEGTYFVLVDFSKVKIPEDYPYILNKGKDFRISHWLINELGVVAIPPTEFYIAENLLRFAVCKDDAYLENAVERLKLLKDY........................ 446
6 -60.7001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  12  5.............................SRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRAL------AQGKTKYAPPAGI-PELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPAVEHDFYLVSDEIYEHLLYSPGRVAPEHTLTVNGAAKAFAMTGWRIGYA-CGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAS--------RAFVEMAREAYRRRRDLLLEGLTALG-LKAVRPSGAFYV------------LMDTSPIAPDEVRAAERLLEAGVAVVPGTDFA-AFGHVRLSYATSEENLRKALERFARVLGR........................ 384
7 -60.4001xi9_A mol:protein length:406 putative transaminase  ali model follow..  15  1..AGSIRASKRALSVEY----------------------AIRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAI------KEGHNYYGDSEGL-PELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDAGEYEIPVISDEIYDLMTYEGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKE-----------YMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGP----------WKNDKEFVLDVLHNAHVLFVHGSGFGYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLKE.................... 400
8 -60.4005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  12  5.............................VALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAAL------HLNQLGYSVALGI-PELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQML-AEIDPPLRGVVVASPANPTGTVIPPEESDVRLISDEVYHGLVYQGAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVP-TVLRRAVDCLTGNFTICPPVLSQIAAVSAFT----------PEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVS-----------DFTSDSLAFCSKLLADTGVAIAPGIDFDTGGSFVRISFAGPSGDIEEALRRIGSWLPSQ....................... 388
9 -60.4001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  14  9.............................SRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFL------QKGEVKYTDPRGI-YELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRAKKRNFYIISDEVYDSLVYTDVSEGFDRIVYINGFSKSHSMTGWRVGYLISS-EKVATAVSKIQSHTTSCINTVAQYAALKALEVDN--------------SYMVQTFKERKNFVVERLKKMG---------------VKFVEPEGAFYLFFKVRGDDVKFCERLLEEKKVALVPGSAFL-KPGFVRLSFATSIERLTEALDRIEDFLNSR....................... 383
10 -59.9001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  4.............................SDRLELVSASEIRKLFD----IAAGMKDVISLGIGEPDFDTPQHIKEYAKEAL------DKGLTHYGPNIGL-LELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTVVEHDLIVISDEVYEHFIYDSLDGMFERTITVNGFSKTFAMTGWRLGFVAAP-SWIIERMVKFQMYNATCPVTFIQYAAAKALKDERS---------WKAVEEMRKEYDRRRKLVWKRLNEMG-LPTVKPKGAFYIFPRIR-----------DTGLTSKKFSELMLKEARVAVVPGSAFGAGEGYVRISYATAYEKLEEAMDRMERVLKERKL..................... 388
11 -59.6003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  20RMTAVVQAVAQRAGTIDVQRNEN-------GKLRAGYLFPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLATRE-GYSGYGAEQGQ-GALREAVASTFYGHAG--RAADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYPDNHFFPDLSKAKRTDIIFFCSPNNPTGAAATARKNGSILVYDAAYALYISNEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKAPVHADWNRVMTTCFNGASNIVQAGGLACLQ----------PEGLKEMNAMIKFYKENAQILKTTFTEMG---------------FSVYGGDDAPYIWVGFPGPSWDVFAEILERCNIVTTPGSGYGAGEGFVRASAFGSRENILEAVRRFKEAYGKRNAS.................... 443
12 -59.5002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  12  11.............................SDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYEN-------KPEVVYYSHSAGI-WELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVI--------ANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRPQNLESFINERTKGIVLSNPCNPTGVVYGAERHGLFLIVDEVYSEIVFSALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELIS-HAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDF-----------VRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPV-------------EDAEEFARWMLTDFNTMVAPLRGFYLGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSSRIS................. 402
13 -59.5002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  15  10....PRGSHMISNKLANIPDSYFGKTMGRKIEHGPLP--------------------LINMAVGIPDGPTPQGIIDHFQKALTIPENQK--YGAFHG----KEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCV--------INPGDYVLLPDPGYTDYLAGVLLADGEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATFKGTDTKIVHDFAYGAFGFDASENGKDVAIEIYSLSKGYNMSGFRVGFA-VGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDFLEE-----------QSNVFKTRRDRFEAMLAKAD-LPFVHAKGGIYV------------WLETPPGYDSEQFEQFLVQEKSILVAPGKPFGEGNRYVRISLALDDQKLDEAAIRLTELAYLYE...................... 398
14 -59.4004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  12  1.....MKPMSDYDIPTTENLYFEGAMIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLP----TAQGYCDSKG----LYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSARQHNLIIFADEIYDKILYDDAEAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFIT---------PGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFN---------HDDQKMVLDFLLQEKVLLVQGTAFNPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ..................... 424
15 -59.4003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  10  1.....................GMSIEAKFKKLGTDNAPGQEVRQSAAGLEALIIEGRPVDFSHGDVDAHTPGAFDLFSAGVQ------SGGVQAYTEYRGD-LGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAAVARGDKVAIVQPDYFANRKLVEFFEGEMVLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAARYGATVIADQLYSRLRYAGASYTHENVVTIMGPSKTESLSGYRLGVAFGS-RAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMED-----------RIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLP-----------KLAVAPAEFVKILRLQAGVVVTPGTEFSHTADSVRLNFSQDHEAAVAAARRIVTLVERYRA..................... 407
16 -59.3001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  10  1..............MSSTSNETMHNKFDLPKRYQGSTKSVWVEYI-----QLAAQYKPLNLGQGFPDYHAPKYALNALAAAANSPDPLANQYTRGFG----HPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGH--------VDEGDEVIIIEPFFDCYEPMVKAAGGSSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDCKKWNVLCVSDEVYEHMVFETLPGMWERTITIGSAGKTFSLTGWKIGWAYGP-EALLKNLQMVHQNCVYTCATPIQEAIAVGFETELKRLKS-----ECYFNSISGELMAKRDYMASFLAEVG-MNPTVPQGGYFMVADWSSLDSKVDLTQETDARKDYRFTKWMTKSVGLQGIPPSAFYSGEDFVRYCFFKKDENLQKAAEILRKWKGSS....................... 429
17 -58.6001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  11  4.............................AARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAAL------EQGKTRYGPAAGE-PRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTAVEAGLWVLSDEIYEKILYDDSPEAYERSVVCSGFAKTYAMTGWRVGFL-AGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQE-----------MLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIA-----------KTGRSSLDFCSELLDQHQVATVPGAAFG-ADDCIRLSYATDLDTIKRGMERLEKFLHG........................ 386
18 -58.6002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  13  5....VNTCKCVATPQEKIEYKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIE-GYSGYGAEQGA-KPLRAAIAKTFYG--GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKY---PENGFFPDLSTVGRTDIIFFCSPNNPTGAAATAKKNGSIIVYDSAYAMYMSDEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKPVAKDFNRIICTCFNGASNISQAGALACLT----------PEGLEAMHKVIGFYKENTNIIIDTFTSLG---------------YDVYGGKNAPYVWVHFNQSSWDVFAEILEKTHVVTTPGSGFGGGEGFVRVSAFGHRENILEACRRFKQLYK......................... 426
19 -58.6006DK6 Entity 1(prereleased)  ali follow..  10  10.............................KLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVD-ELGNRSTFKGYGPEQGY-DFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYALKCTPENGFVPDIPQEKADLIYLCYPNNPTGAVATARENGSVLLYDAAYEAFIQDEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSALHPLWSRRHSTKFNGASYIVQKGAEALYT----------DEGKSQTKALIEHYMGNAALLVEACKNAG-LSVFGGVNAPYV------------WVGCPAGLTSWQMFDKMLNEANVVITPGSGFGSGEGYFRISAFNSRANVEEVCRRIAAL........................... 410
20 -58.5001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  13  20..................................................GLAQRLGAVNLGQGFPSNPPPPFLLEAVRRAL-------GRQDQYAPPAGL-PALREALAEEFA------VEPESVVVTSGATEALYVLLQSVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGARAHDLFLISDEVYDELYYGEREFAPERTFTVGSAGKRLEATGYRVGWIVGP-KEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLARR---------EGFYEALREGYRRRRDLLAGGLRAMG-LRVYVPEGTYFLMAEL-----------------PGWDAFRLVEEARVALIPASAFYLPKDLFRFAFCKTEEELHLALERLGRVVNSPREAEGGAV............... 379
21 -58.2004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  14  6.......SKRFNKNLNKIEVSMIRQF----------------------DQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAI------DADESHYTGMAGL-LALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAI--------LEPGDKVLLPAPAYPGYEPVVNLIDTRSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSLKKYPIFVISDEVYAELTYTGAEYLPDQTILISGLSKSHAMTGWRLGLIFAP-AVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALP-----------MKEEYIKRRDYIIEKMEAMK-FKIIKPDGAFYIFAKIPVA----------QGQDSFKFLQDFAKEKAVAFIPGVAFGYGEGYLRISYAASMETIKEAMKRLKEFMEQYAD..................... 393
22 -58.1003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  13  18..................................................EITPKKRGLDLGIGEPQFETPKFIQDALKNHT-------HSLNIYPKSAFE-ESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFV------LFDYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKESLNEKELQEVDLVILNSPNNPTGRTLSALKHDFILINDECYSEIYENT-NEAFKNVLVIHSLSKRSSAPGLRSGF-IAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLD------------DRHAEFFRNIYANNLKLARKIFKNT-------------------LIYPYSFYVYLPVQ-NGENFAKTLYQNEGIITLPALYLGRGADYVRLALVYDTPLLEKPLEIIETYRENHA...................... 376
23 -58.1002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  13  1...............................MSRVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTTYG--YCLKSC----TLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLAL--------TEPEDLLLLPEVAYPSYFGAARVASLRREDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADARKHGLWLIHDNPYVDQVYEALPGAKERVVELFSLSKSYNLAGFRLGFA-LGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRG-----------YARVYRERALGMAEALKGV--LSLLPPRATMYL------------WGRLPEGVDDLEFGLRLVER-GVALAPGRGFGGGKGFVRIALVRPLEELLEAAKRIREALD......................... 376
24 -58.0004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  10  1.....MAKQLQARRLDGIDYNPWVEF-----------------------VKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVS-GDFMLNQYTKTFG----YPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQAL--------VDEGDEVIIIEPFFDCYEPMTMMAGGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSCQQHDVVCITDEVYQWMVYDSLPGMWERTLTIGSAGKTFSATGWKVGWVLGP-DHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQP----SSYFVQFPQAMQRCRDHMIRSLQSVG-LKPIIPQGSYFLITISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSFDHYIRFCFVKDEATLQAMDEKLRKWKVELENLYFQGKGGRADPAFLYK.... 441
25 -57.7005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  11  73.............................SPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAI------REGFTRYTLNAGI-TELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLPRLLVLSDEIYEHIIYASLPDMYERTLTVNGFSKAFAMTGWRLGYL-AGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGLGKAG--------GETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAY--GSEAEGFGLINDSSSLALYFLDKFQVAMVPGDAFG-DDSCIRISYATSLDVLQAAVEKIRKALEPLRATVSV................. 475
26 -57.7001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  6...........................VSMSNHAGLVFNPIRTVSDNAKPSPS-PKPIIKLSVGDPTLDKNLLTSAAQIKKLK-EAIDSQECNGYFPTVGS-PEAREAVATWWRNSFKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSAEELRLPLFSDEIYAGMVFKGKDETTVPRVILGGTAKNLVVPGWRLGWLLYVDPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQ-----------IVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEK-------YRDIKTDVEFFEKLLEEENVQVLPGTIFH-APGFTRLTTTRPVEVYREAVERIKAFCQRHAA..................... 415
27 -57.1002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  13  11.............................FARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDTHG--YSTSRG----IPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVEAKQYDVMVVHDLAYADIVYDQVPGAKDIAVEFFTLSKSYNMAGWRIGFM-VGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRD-----------IARQYQQRRDVLVKGLREAG-WMVENPKASMYVWAKIPEPYAH---------LGSLEFAKKLLQDAKVSVSPGIGFGDGDDHVRFALIENRDRLRQAVRGIKAMFRADGLLSPQRKV.............. 407
28 -57.0001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  10  2....TNNPLIPQSKLPQLGTTIFTQM-----------------------SALAQQHQAINLSQGFPDFDGPRYLQERLAHHV------AQGANQYAPMTGV-QALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITAL--------VRNGDEVICFDPSYDSYAPAIALSGGQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADHEIFVISDEVYEHINFSAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAP-APISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLA-----------LPDFYRQKRDILVNALNESR-LEILPCEGTYFLLVDYSAVS----------TLDDVEFCQWLTQEHGVAAIPLSVFCAPHKLIRLCFAKKESTLLAAAERLRQL........................... 386
29 -56.5005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  12  19..................................................KLAADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQ--YTRGFG----HPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGL--------VDPGDEVIIMVPFYDCYEPMVRMAGATSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTCVKHDTLCISDEVYEWLVYTTLPGMWERTITIGSAGKTFSVTGWKLGWSIGP-AHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDP----ECYFNSLPKELEVKRDRMVRLLNSVG-LKPIVPDGGYFIIADVSSLGADLSDM--SDEPYDYKFVKWMTKHKKLTAIPVSAFCDFEKLVRFCFIKKDSTLDAAEEIFRAW........................... 410
30 -56.5004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  15  34....GSTKLVRNVNLEKLKNNY-----------------PEINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLSTVE-GYRGYGLEQGN-KTLRKAIAETFYRDLH--VKSNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKY---PNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASAKTNGSIIIFDSAYAAFIEDEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDEPIINDFHRIVTTSFNGASNIAQAGGLACLS----------SGGLKEIRSVNNYYKENRKILMDTLVSLG---------------LKVYGGVNAPYLWVHFKGKSWDVFNEILENTHIITVPGSGFGGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTKHFTYLSSTSNTN......... 456
31 -56.1003ele_A mol:protein length:398 Amino Transferase  ali model follow..  14  1.......................GMVVNESMYQLGSVRSAIRELFEYGKKRAAIVGNVYDFSIGNPSIPAPQIVNDTIKELV--TDYDSVALHGYTSAQGD-VETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRAL-------TSDAYDEFITIAPYFPEYKVFVNAVPADTEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETRPIFIIADEPYREIVYDFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDE-VYDKAELYAAVCGVCAPSLFQKMIVKCQGATG----------------DINAYKENRDLLYEGLTRIG---------------YHCFKPDGAFYMFVKALEDDSNAFCEKAKEEDVLIVAADGFG-CPGWVRISYCVDREMIKHSMPAFEKIYKKYNK..................... 398
32 -56.1002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  14  20..................................................ALATRIGAVNLGQGFPDEDGPPKMLQAAQDAI------AGGVNQYPPGPGS-APLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSAVAANLVVITDEVYEHLVFDGFDGMAERTITISSAAKMFNCTGWKIGWACGP-AELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAA-----------LRNSLRARRDRLAAGLTEIG-FAVHDSYGTYFLCADPRPLG-----------DDSTEFCAALPEKVGVAAIPMSAFCDPNHLVRFTFCKRDDTLDEAIRRLSVLAERPATG.................... 399
33 -56.1003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  15  28..................................................LENPQHTVINLSIGDTTQPLNASVAEAFASSIA-RLSSPTTCRGYGPDFGL-PALRQKLSEDFYRGF---VDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENAFFPEFPE-----DTHIDILCLCSPNNPTGTVLNAIEHEILILFDAAYSTFISDEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQEFVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ-------------LEAIHYYRENSDLLRKALLATG-FEVFGGEHAPYLWVKPT-----------QANISDRDLFDFFLREYHIAITPGIGFGSGSGFVRFSSLGKREDILAACERLQMAPALQS...................... 394
34 -55.5003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  15  1.............................GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGT---KLNYGWIEG----SPAFKKSVSQLYTG-----VKPEQILQTNGATGANLLVLYSLEPGDHVISLYPTYQQLYDIPKSLGAE-VDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDASEVGAYILSDEVYRSFSELDVPSVYDKGIAVNSLSKTYSLPGIRIGW-VAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAH-----------YQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTS------------FVKIAVDMPMEDFCLQLLQEHGVLLVPGNRFER-DGYVRLGFACEQETLIKGLEKLSQFLRRFDKE.................... 374
35 -55.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  11  17.............................SLRPRREDPPVLEEWYR--RHLGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAV---VMDDSVSQG----GEGVRRAIADRYAG-----GDADRVLVTHGSSEAIALTLNALHRGDRVVVQEGIYHSLGHYPRAAGCD-VAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSTAATGAVLVWDAATAEIAHRDPGADGGDTVSYGTLSKTFGLPGLRVGW-AVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRH-----------ADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELERAAA-----GPQEVERFCLELLERHRTLLVPGTAFGA-PHGARLGFGGPQEDFRAGLDGLSRFLRERAAG.................... 399
36 -54.9003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  12  28AVEYAVRGP--VLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPLDSPSFPEDAKKRARRILQACGGN----SLGSYSASQGV-NCIREDVAAITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGG----KSRTGVMIPIPQYPLYSAVISELDDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSAWEEKLFLLADEVYQDNVYSPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA.................. 492
37 -54.8003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  12  44..NWIQTLARLA-GVTESKLTINNGIMAGYINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAV--------ANNYPVPDRCL-VNTEKIINYFLQELDANLAEQTDLFPTEGGTAAIVYAFHSLA---ENHLLKKGDKIAINEPIFTPYLRIPELKDYEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNAPKLMIISDEVYGAFVPNFYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFD-DNIAHLDKVELRQLHKRYSSVVLDPDKMKFIDRLCADSRSI-GLYHTAGLSTPQQIMEALFSMTHLLTSTNGGSDDPYIDIATDTNTHYYSLIDIYREQVDFLLKLAEKNGVVLVDGVGFGAKPGELRVSQANLPTEYALIGKQVLELLKEYYEEFKQNN............... 533
38 -54.7003jtx_A mol:protein length:396 aminotransferase  ali model follow..  12  3.............................NTLLKQLKPYPFARLHE-QGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLH----ELEKYPLTAG----LPELRQACANWLKRRYDGLTADNEILPVLGSREALFSFVQTVLNPVSDGIKP---AIVSPNPFYQIYEGATLLGGGPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDQDKYGFIIASDECYSEIYFDQLGRSRQKLLMFTSLSKRSNVPGLRSGF-VAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVID------------NRRLYQEKFERVIPILQQVFDVK----------------LPDASFYIWLKVPDDDLAFARNLWQKAAIQVLPGRFLARGEGYVRIALVADVATCVKAAEDIVSLYR......................... 396
39 -54.5003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  10  10....LIREKQNELHIKDLGMASIRDLV------------------LVTNLEKATGTKFCRMEMGVPGLPAPQIGIETEIQKL-----REGVASIYPNLDGL-PELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVANR----THKNREYGTLFIDPGFNLNKLQCRILGQEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTATKHDVIVIEDLAYFGMDFRSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEEALSSGATHSAQWGMAAMLKACNDGEYNFRD--------SVIEYGRKARIMKKMFLDNGDKDGNEPLADGFY------------FTVGYKGMDSSKLIEKFVRYGMCAITLKTTGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE........................ 436
40 -53.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  10  4...........GVDLGTENLYFQSMWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDAL-----DSGKYNGYAPSIGF-LSSREEIASYYHC-PEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSAARQCVPILADEIYGDMVFSATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIRDGLVKLSQRILGPCTIVQGALKSILCRTP----------GEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEH-------FPEFENDVEFTERLVAEQSVHCLPATCFEY-PNFIRVVITVPEVMMLEACSRIQEFCEQHYHC.................... 421
41 -53.3003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  10  1...WNVRPSDMSNKTFN----------------------PIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDAL-----DSGKYNGYAPSIGY-LSSREEVASYYHC-PEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSAERQCVPILADEIYGDMVFSATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIRDGLVKLSQRILGPCTIVQGALKSILQRTP----------QEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEH-------FPEFENDVEFTERLIAEQSVHCLPATCFEY-PNFFRVVITVPEVMMLEACSRIQEFCEQH....................... 401
42 -53.1005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  6.............................................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVN-ELPVLWAESEQRPVQQIESEAHQAYFTLLGQ-HGYPAEPGRVLSCYSSSVSMEILARSL--------SASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALDLSAELLSSVGCVFVTTPNNPTGRVLAEERHGTVLALDTSFRGFDAAALQEAGCRWVVIEDTGKLWPTLDLKAGLLVF-SEDIGLPVEKIYSDILLGVSPLILALIREFSR----------DAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSS-------------VERVAFAGRTGTEVWEELQRHHVFALPCRQFHDGDHMVRIALSRSTEPLEKSVQVLRTVLETR....................... 376
43 -52.9004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  11  57...................................................SRSTKSNLRLSIGDPNLKTPDIVTEAMVDVV-----RSGKFNGYPPTVGA-DNLRQVVSTYWRRFCQTKLKWENVIITSGVSQAIVLALTAL--------CNEGDNILVCAPSFPHYKSVCDSYGDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSCQQHQIPLISDEIYAEMVLNNGIFTSVPRLILGGTAKYQVCPGWRVGWSILIDPDWAVGMERLTQ-LIAGVNSICQEAIARTL----------LKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSY-------FQDLKSDMEFYEKLLDEENVQVLPGEIFGM-SGFLRATVSRPSAVLNEAVDRIIEFCERHKK..................... 438
44 -52.8003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  11  24KCEYAVRVIHAQRLQEQLKTQPGSLPFLYCNIGNPQSLGQQPVTFFREVLALCDHPDLLQREEIKTLFSADS-ISRAKQILAMIPGRATGAYSHSQG----IHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLL-------IRNEKDGILVPIPQYPLYSASIALHGNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLACKNEGLVLLADEVYQENIYVD-EEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSEYR.................. 489
45 -52.0006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  1..............MGSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQA---------YEKRFTEAFFQLHRQ--PTALVKNKTMLSYAASISTMVAGMFL--------KKERLAVTLIEPCFDNLYDVLANMDDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLLCKDHDKLLLIDFCFASFTLELLENSGVRYLAIEDTGKTWPVQDAKCAL-ITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVR----------DSAADRLASVREVLTRNRECARKTLDGSI-LEYQEPVVKVSV-----------AWFRVDHPELTATDVHRLLSADGVYVLPGRYFYKGDAYVRMALAREPEMFADAMALTRQVLDRHGR..................... 407
46 -51.4002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  13  41..NFLATTPRRAGVGGLAKLDGIEGRF------------ERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGIL------GCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLR----SGLLKAGDKVAIGMPVFTPYIEIPELAQDPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSPDLLILTDDVYGTFADSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHAL-------SQLPESAKKALDHRYRSLLPDVRS-----------LKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALENPNSVNYQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADE....................... 520
47 -50.8003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  12  1....GMTFSLFGDKFTR---SGITRLMEDLNDGLRTP-------------------GAIMLGGGNPAHIPAMQDYFQTLLTDMVESGKAADALCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFADGSTKKVLFPLAPEYIGYADSGLEDDLPNIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITANQHNIPLVIDNAYGVPFPEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDK-TITAIANMNGIISLAPGGMGPAMMCEMIKR--------NDLLRLSETVIKPFYYQRVQQTIAIIRREERCLIHKPEGAIFL------------WLWFKDLPITTELLYQRLKARGVLMVPGHYFFPGHQCMRMNYVPEPDKIEAGVKILAEEIERAWRE.................... 416
48 -49.9002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  12  41..NFLATTPRRAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--------GCNYPVPPRML-NISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFESLK----NGLLKAGDKVAIGMPVFTPYIEIPELAQDPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSPDLMILTDDVYGTFADSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFD-LALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVYKHTLKQLIRRRETTLYRELGMPPLR--ENAVDYYTLIDLQDVTAEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSGQAQNLKLAAALE.... 540
49 -49.7003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  12  41..NFLATTPRRAESELSYSYMNTVGVGGLAKIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--------GCNYPVPPRML-NISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFESMK----NGLLKAGDKVAIGMPVFTPYIEIPELAQDPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSPDLMILTDDVYGTFADSLFAICPANTLLVYSFSKYFGATGWRLGVVAAH-KENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLVADSRAVYKHTLKQLIRRREATLYRELGTP-PQRDENAVDYYTLIDLQDLYGEAFSKWAVKQSSTGDMLFRIADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRLRQMADELYAQYTQQG............... 530
50 -48.8001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  13  22.......................................GWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNP-KNGESIFAELALFQDYHGL-PAFKKAMVDFMAEIRGVTFDPNHLVLTAGATSANETFIFCLDPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNEKGIHLISDEIYSGTAFSSPSFISQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLV--SSQTQHLLSAMLSD--------KKLTKNYIAENHKRLKQRQKKLVSGLQKSG-ISCLNGNAGLFCWVDMR------HLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEGWFRVCFANLPERLDLAMQRLKAFVGEYYNVPEVNGGSQSSHLSHSRR... 452
51 -48.4003if2_A mol:protein length:444 Aminotransferase  ali model follow..  10  4...........................FSKFGQKFTQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDA--NDNDTGKANSSAIISMANYSNPQG----DSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGSQDKESKSVDKSILLPLTPEYIGYSDVHVEGQHFAAVLPHALENLPALKEGRIGAICCSRPTNPTGNVLTAKRYDIPLIIDNAYGMPFPNAHLNWDNNTILCFSLSK-IGLPGMRTGI-IVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVAN--------DRIKQLSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFL------------WLWFKDLPISTLDLYERLKAKGTLIVPSEYFFPGHECIRMSIAADEQTLIDGIKVIGEVVRELYDN.................... 443
52 -48.2001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  11  3........SKLATNEEHGENSPYFDGW--------------KAYDSDPFHPLKNPNGVIQMGLAENQLCLDLWIKRNPKGSICSEGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLDPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTHNIHLVCDEIYAATVFDTPQFVSDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGLVSTQTQYFLAAM-----------SDEKFVDNFLRESAMRLGKRHKHFTNGLEVVG-IKCLKNNAGLFCWMDLR------PLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEGWFRVCFANMDDGVDIALARIRRFVGVEK...................... 428
53 -40.4002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  11  9SLNEQLQQSNAT-AFAMLSDLGQNMFYPKGILSQ----------------SAEAKSTTYNATIGMATNKDGKMFASSLDAMF--NDLTPDEIFPYAPPQGI-EELRDLWQQKMLRDNPSIDNMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALQKDKVIMILNYPNNPTGYTPTHKETKVIAVVDDAYYGLFYEDLHSNAILPIRLDGATKEFFAWGFRVGFMTFGKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTL----KERYEVTKEVVYADQYHSH---------------WQAYDFNSGYFMAIKVHDDPEALRKHLIDKYSIGVIALNATD-----IRIAFSCEKDDIPHVFDSIAKAIDDLR...................... 430
54 -38.6003fkd_A mol:protein length:350 L-threonine-O-3-phosphate decarboxylase  ali model follow..  6..............................................GDEGITPLSSEIVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAG---------TLRQMLAKRNS------VDNNAILVTNGPTAAFYQIAQAFRGS----------RSLIAIPSFAEYEDACRMYEHEVCFYPSN-EDIGEADFSNMDFCWLCNPNNPDGRLLQRTEPDTTFVLDQSYEEVIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVA-NKDFMKRVAAFST----AVNALAIEAAKFILIH------------PAQFTLPIRKWQRNTVDFITALNRLDGVEV---------------HPSGTTFFLLRLKKTAAELKKYMLEEYNMLIRDASNFGLDESYVRITTQRPAQN-QLFIKALETFLEKYE...................... 343
55 -38.4001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  14  11..........................................NIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDADYF---------HLHQALARHHQ------VPASWILAGNGETESIFTVASGLKPR----------RAMIVTPGFAEYGRALAQSGCEIRRWSLREAAILEALTPDLDCLFLCTPNNPTGLLPERPLLNINLILDEAFHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQM----SVNALAALAGEVALQD------------SAWQQATWHWLREEGARFYQALCQLPLLTV---------------YPGRANYLLLRCEREDIDLQRRLLTQ-RILIRSCANYGLDSRYYRVAIRSAAQN-ERLLAALRNVLTGIAPA.................... 363
56 -37.8002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  15  25.......................................................RDKTYLALNENPFPFPEDLVDEVFRRLNSDALRI--------YDSPDEELIEKILSYLDTDF---LSKNNVSVGNGADEIIYVMMLMFD------------RSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDRIPEVNVGEGDVVFIPNPNNPTGHIERILKTGAFVALDEAYYEESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVA-SEKFIDAYNRVRL--PFNVSYVSQMFAKVALDH------------REIFEERTKFIVEERERMKSALREMG----------------YRITDSRGNFVFVFMEKEEKERLLEHLRTKNVAVRS-------REGVRITIGKREEN-DMILRELEVF........................... 340
57 -37.8003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  13  19................................................TEGVFKGRELLDYSSNINPLGIPKSFLNNIDEGIKNLGVYPDVNYR---------RLNKSIENYLK------LKDIGIVLGNGASEIIELSISLFE------------KILIIVPSYAEYEINAKKHGVSDENMCIDYEDIISKID-DVDSVIIGNPNNPNGGLKLAEEKKKTIIIDEAFIEFSFVGEIKNYSCLFIIRAMTKFFAMPGIRFGYGITNNKEIAAKIKAKQN----NINCFAEMAAINCLKD------------TNYIEESLLWIKKERKRFIEELNKIGFIK--------------RVFSPHANFVLCRLENISGEKLYDSLLKEDIVIRRCCNFGLDDSFVRFAIKDEKKN-TKFLRALKGVENN........................ 360
58 -37.5003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  11  26......................................................LNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAV-----ELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMD-VALEEIRAKQPDIVFVTTPNNPTGDVTSLDD-PGIVIVDEAYAEFSTTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVA-NPAFIDAVMLVR--LPYHLSALSQAAAIVALRH------------SADTLGTVEKLSVERVRVAARLEELG----------------YAVVPSESNFVFFGDFSDQHAAWQAFLDR-GVLIRD---VGI-AGHLRTTIGVPEEN-DAFLDAAAEIIKLNLSAWSHPQ............... 373
59 -37.5003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  11  30.......................................................KEVIKLASNE----NPFGTPPKAIECLRQNANKAHLYPDDSMI-----ELKSTLAQKYK------VQNENIIIGAGSDQVIEFAIHSK--------LNSKNAFLQAGVTFAMYEIYAKQCGAKITHNLDEFKKLYETHKDEIKLIFLCLPNNPLGEFIKGVNEDCLVVIDAAYNELEPCELIKEFDNVLYLGTFSKLYGLGGLRIGYGIA-NANIISAFYKLRA--PFNVSNLALKAAVAAMDD------------DEFTEKTLENNFSQMELYKEFAKKHN----------------IKIIDSYTNFITYFFDEKNSTDLSEKLLKKGIIIRNLKSYGL--NAIRITIGTSYEN-EKFFTEFDKILR......................... 365
60 -37.4003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  13  26.......................................................ASWIKLNTNENPYPPSPEVVKAILEELGPDGAALRIYPSASSQ-----KLREVAGELYG------FDPSWIIMANGSDEVLNNLIRAF--------AAEGEEIGYVHPSYSYYGTLAEVQGARTFGLTGDFRIAGFPERYEGKVFFLTTPNAPLGPSFPLEY-AGMLVLDETYAESNALELVRRHENVVVTRTLSKSYSLAGMRIGLAIA-RPEVIAALDKIRD--HYNLDRLAQAACVAALRD------------QAYLSECCRRIRETREWFTTELRSIG----------------YDVIPSQGNYLFATPPDRDGKRVYDGLYARKVLVRHFSDPLL-AHGMRISIGTREEM-EQTLAALKEIGE......................... 353
61 -37.2004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  11  32..................................................EKYGREAVINAALGTLLDDKGKIIALPSVYDRLDEMDRSHIASYAPIEG--EKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSY--------LDEGDPLICHDYYWAPYRKICEEFGRNAFNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEKKITLIVDVAYLEFAGDGDQQRK-FVVVAFSMSKSHTAYGLRSGAAVGSSKEIIEEFEASLAHSARCNWSNGTHAAQNILIELER--AENKKIYEQELVDLRNMLKSRADVFVTAAKENK-LTMIPYFGGFFTFI----------------PTDKAFDIVKDLEKENIFTIPSAKGI------RVAICGGEEKIPKLVQRLAFYTNKK....................... 413
62 -36.9003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  15  32.......................................................TKITKLSSNE----NPLGTSKKVAAIQANSSVETEIYPDGWAS-----SLRKEVADFYQ------LEEEELIFTAGVDELIELLTRVL--------LDTTTNTVMATPTFVQYRQNALIEGAELQDGEHDLEGMLNAIDEKTTIVWICNPNNPTGNFLDRVPSDVLVVLDEAYIEEKHEKLVRTYKNLIITRTFSKIYGLASARVGYGIA-DKEIIRQLNIVRP--PFNTTSIGQKLAIEAIKD------------QAFIGECRTSNANGIKQYEAFAKRFEKVKLY---------------PANGNFVLIDLGIEAGTIFSYLEKN-GYITRSGAALGF-PTAVRITIGKEEDN-SAVIALLEKLL.......................... 363
63 -36.8004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  14  23.......................................................PGAIKLASNE----TVFGPLPSVRAAIDRATDTVNRYPDNGCV-----QLKAALARHL----GPDFAPEHVAVGCGSVSLCQQLVQVT--------ASVGDEVVFGWRSFELYPPQVRVAGAIPIDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTFVEAVPAHILIAIDEAYVEPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIG-HPDVITALDKVYV--PFTVSSIGQAAAIASLDA------------ADELLARTDTVVAERARVSAELRAAG----------------FTLPPSQANFVWLPLGSRTQDFVEQAADA-RIVVRPYG-----TDGVRVTVAAPEEN-DAFLRFARRWRSDQKLAAA.................. 359
64 -36.7003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  19...................................................TRYGQGVLPLWVAESDFSTCPAVLQAITDAV---QREAFGYQPDG------SLLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTP----AYPPFFHLLSATQREGIFIDATGGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWYDARVLVDEIHAPLVFDGSDTAASVCITITAPSKAWNIAGLKCAQIIFSNPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRIPGAK------------------------ITPMQATYLMWIDFRD-EGSPSEFFIEKAKVAMNDGAWFGDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT...................... 377
65 -36.7003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  11  16.......................................................AQAVCLAFNE----NPEAVEPRVQAAIAAAAARINRYPFDAEP-----RVMRKLAEHFS------CPEDNLMLVRGIDECFDRISAEF----------SSMRFVTAWPGFDGYRARIAVSGLRHFEIGLTDD--DLAQVSRDDCVVLANPSNPTGQLDQLRQRAGKLLIDETYVDYSSFRARAYGENELVFRSFSKSYGLAGLRLGALFG-PSELIAAMKRKQW--FCNVGTLDLHALEAALDN------------DRAREAHIAKTLAQRRRVADALRGLG----------------YRVASSEANFVLVEN--AAGERTLRFLRERGIQVKDAGQFGL-HHHIRISIGREEDN-DRLLAALAEYSDHS....................... 337
66 -36.6004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  11  31......................................................LAVPVRLNTNENPHPPTRALVDDVVRSVREAAIDLHRYPDRDAV-----ALRADLAGYLTAQTGIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDFGLDVD-VAVAAVVDRKPDVVFIASPNNPSGQSVSLPD-PGIAIVDEAYGEFSVSLVEEYPSKLVVTRTMSKAFAFAGGRLGYLIA-TPAVIDAMLLVR--LPYHLSSVTQAAARAALRH------------SDDTLSSVAALIAERERVTTSLNDMG----------------FRVIPSDANFVLFGEFADAPAAWRRYLEA-GILIRD---VGI-PGYLRATTGLAEEN-DAFLRASARIATDLVPVTRSPVGAPKLAAALE..... 388
67 -35.8003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  13  16.......................................................DNPIRINFNE----NPLGMSPKAQAAARDAVVKANRYAKNEIL-----MLGNKLAAHHQ------VEAPSILLTAGSSEGIRAAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDNWAFDIEGLKAAVAAYSGPSIVYLVNPNNPTGTITASKPANTMFIVDEAYAEFVNDPITQGAENIILLKTFSKIHAMAGMRVGYAVA-HPTVIALMGRYVA--GEKINFSGVDAALASMND------------SAFITYSKKSNDVSRQILLKALEDLK----------------LPYLPSEGNFVFHQLVVPLKDYQTHMADA-GVLIGRAFP----DNWCRISLGTPQEM-QWVADTMREFRKK........................ 351
68 -35.6003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  3..............................ENITAAPADPILGLAD--LFRADERPGKINLGQGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGI-PEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINEAQAGDVVLFHGCCHNPTGIDPTLVEKGWLPLFDFAQQGFARGAFAAMHKELIVASSYSKNFGLYNERVGACTLVAARAFSQMKAAIYANYSNPPAHGASVVATILSN-----DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL--------------TKEQVLRLREEFGVYAVASG---------RVNVAGTPDNMAPLCEAIVAVL.......................... 396
69 -35.5002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  15  1.MDYTKYLAGRANWIKG---------------------SALADVMKKASELQKKGVKLISLAAGDPD---PRAVLGEIAKEVLEKEPKSVMYTPANG----IPELREELAAFLKKYDHLEVSPENIVITIGGTGALDLLGRVL--------IDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDGMELKAKGQKVKLIYTIPTNPMGVTMSASKYDLLIIEDTAYNFMRYEGGDDNEGRVIVAGTLSKVLG-TGFRIGWIIAEGE-ILKKVLMQKQPIDFCAPAISQYIALEYLKRGY---------EKYHLEGALLGYKEKRDIMLKALEN-------------HLPNAEFTKPIAGMFVMFFLPEDGISFANELMEREGVVVVPGKPFESGKNAIRLNFSRSKEEIPIGIKKLAKLYKEKFGE.................... 407
70 -35.3003ez1_A mol:protein length:423 Aminotransferase MocR family  ali model follow..  11  3.............................TKEASRPALDLARQAYE----AFKARGLNLNMQRGQPA-LSNGLLTVLGAEDVRMDGLDLRNYPGGVAG---LPSARALFAGYLDVKNNSSLELQGLVLTFALLHGVRGSTGPW--------LSQTPKMIVTVPGYDRHFLLLQTLGFELLTVDMQVDAVERLAGTDPSVGILFVPTNPGGETISAAAPDFTIFADDAYRVHHLVEEDRAEDRAFVFASTSKITF-AGAGLGF-VASSEDNIRWLSKYLGAQSIGPNKVEQARHVKFLT-------EYPGGLEGLMRDHAAIIAPKFRAVDEVLRAE----------GEGGEYATWTLPKGGYFISLDTAEPVADRVVKLAEAAGVSLTPAGATDPHNRNLRLAPTPPVEEVRTAMQVVAACIRLATEEYRAGH............... 423
71 -34.8001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  12  36..................................................KLVETSDVISLAGGLPATFPVETIKKIAVEVLEEHADKALQYGTTKG----FTPLRLALARWMEKRYDIPMSKVEIMTVAGSQQALDLIGRVF--------LNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKGMELRKQGKRVKIVYTVSTNPAGVTMSANEYDFLIVEDGPYSELRYSGEPDDYGRVIYLGTFSKILA-PGFRIGWVAAHPH-LIRKMEIAKQSIDLCTNTFGQAIAWKYVE---------NGYLDEHIPKIIEFYKPRRDAMLEALEEY----------------VEWTKPEGGMFVRVTLPEGDTKLMMERAVAKGVAYVPGEAFRDKKNTMRLNFTYPEETIREGVRRLAETIKEEMKRVKG................. 417
72 -34.6003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  11  23......................................................NEELIHAWIADMDFEVPQPIQTALKKRIEHP-----GYTLPP------ENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEEYNVIVVADEIHSDIIYADSEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAMSAYTECNDWLNEIRFYIEDNAKFACEYIKDHIPTLS------------------------VMKPEGSFLLWIDCSASQDERTKLLEEKGKIIVEPGEKYGGGEEHIGINIGCPRSVLEEILNRLRHTFS......................... 383
73 -34.6003d6k_A mol:protein length:422 Putative aminotransferase  ali model follow..  12  3AMSLKDYDAARLAQVREEVTAKYAEL--------------------------KAKNLSLDLTRGKPS-LSNDLLSLPGGDFRTKDGVDCRNYGGLLG----IADIRELWAEA------LGLPADLVVAQDGSSLNIMFDLISWSYTWGNWSAEEKVKWLCPVPGYDRHFTITEHFGFEMINVPMTMGVVRELVKDPQVKGMWTVPGNPTGVTFSEQTPDFRIVWDNAYALHTLSDAAGNPNRFWFMSSTSKITH-AGSGVSF-FASSKENIEWYASHANVRGIGPNKLNQLAHAQFFGDV--------AGLKAHMLKHAASLAPKFERVLEILDS----RLSEYGVAKW------TSPTGGYFISVDVVPGTASRVVELAKEAGIALTGAGSSDPNNENIRLAPSPPVAELEVAMDGFATCVLM........................ 417
74 -34.4004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  14  36.......................................................KIAARIGANE----SGFGPAPSVLLAIRQAAGDTWKYADPENH-----DLKQALARHLG------TSPANIAIGEGIDGLLGQIVRLV--------VEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYAEGLLAAVGRENAPLVYLANPDNPMGSFAQALPETTLLVLDEAYCETAPRDSLIDKPNVIRARTFSKAYGLAGARIGYTLS-TPGTAQAFDKIRN--HFGMSRIGVAAAIAALAD------------QDYLKEVTLKIANSRQRIGRIAADSG----------------LAPLPSATNFVAVDCGKDASYARAIVMSDHGIFIRMPGVAPL-NRCIRISTAPDAEM-DLLAAALPEVIRSLAAT.................... 376
75 -34.1003ue8_A mol:protein length:439 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  13  1.MNYARFITAASAARNPSPIRTMTDI------------------------LSRGPKSMISLAGGLPNFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHPPSQGQMDLCVTSGSQQGLCKVFEMI--------INPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIAKNPQKNTPKFLYTVPNNPTGNSLTARKYDFLIIEDDPYYFLQFNKFRDVDGRVIRADSFSKIIS-SGLRIGF-LTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHE-------GEEGFMAHVDRVIDFYSNQKDAILAAADK------------WLTGLAEWHVPAAGMFLWIKVKGDVKELIEEKAVKMGVLMLPGNAFSAPSPYLRASFSASPEQMDVAFQVLAQLIKESLLVPR.................. 429

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24