current user: public

If you have questions about the server, please let us know.

Query: 1ngk_A mol:protein length:128 Hemoglobin-like protein HbO, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPFLast
1 -73.9001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model  100  1MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF 128
2 -65.3002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  58  2...TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDL---ALPAHLEQQLWEYLVYAAYAMVNVP. 122
3 -63.6004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  30  21.EKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLE---VDNPLLREGLKQSFGQLASHMINQ.. 144
4 -61.9005d1v_A mol:protein length:127 Globin  ali model follow..  47  3.EPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEA---GVPEPARSVMENYFRHAAQAMMNRL. 124
5 -61.9002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  32  5.TVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDET---IENAKLREIIWAPVERLAFHMQNQE. 129
6 -61.1005v3t_A mol:protein length:132 Globin  ali model follow..  35  5.PMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDT---GVHGHIREFVFERLALTAQHMVNTP. 126
7 -60.5004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  54  33.QMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDL---ALPAHLEQQLWEYLVYAAYAMVNVP. 155
8 -60.4002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  38  3.WQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEI---GLSGPAREQFYHRLVLTAHHMVNTP. 124
9 -59.7004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  15  7.ADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQEL---GVAQELKAEAMAIVASARPLIFGTG. 129
10 -58.2002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  19  12.PISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAA---GVPSETITEILGVIAPLAVDVTSGE. 130
11 -58.2001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  20  12.PISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAA---GVPSETITEILGVIAPLAVDVTSGE. 130
12 -58.1006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  15  1..STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEM---GVGQELIDEAAGVLIGVRPLFDPER. 122
13 -57.8003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  20  4.PQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKEL---GVTDAVINEAAKVIEHTRKDMLGK.. 121
14 -57.2002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  17  1..ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQEL---NVSQDLIDEVVTIVGSVRNDVLNR.. 123
15 -56.7001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  18  1...SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGA---GVAAALVEQTVAVAETVRGDVVT... 115
16 -56.5001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  16  2..STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEM---GVPEDLIAEVAAVAGAHKRDVLNQ.. 124
17 -56.2001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  17  41CPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTEL---GVPPEDITDAMAVVASTRTEVLNMP. 162
18 -54.2004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  26  24.ESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDS---DIDQDSKIKMMKFFRHTAFFLVAGN. 148
19 -53.9001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  38  5.FNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHV---GLEGEIREFLFGRLELTARHMVNQT. 125
20 -51.8004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  20  50.PSKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDV---HFPLSVLEEFWQWIESFSIRMINRR. 173
21 -48.2002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  11  1....MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYKYG. 125
22 -16.7001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  19  8RVMQSYGRCCASTGF---FDDFYRHFASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHD-RDCDAETRDAWRDVMGRGIAVIKSY.. 131
23 -15.2002w31_A mol:protein length:162 GLOBIN  ali model follow..  29...........ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASY 150
24 -14.6004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  11  32...........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVDDVERLIQITVAEVHARIGIPVEIVEMGFRVLKKILPVIFSSDYSAAEKLQVYHFSINIAMEVMTRAF 155
25 -14.4005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  13  34...........APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHGDPPELERVRNALGKVLDLELAV 152
26 -14.4001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  11  59...........QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLV.... 176
27 -14.2004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  10  32...........TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASLSAAQRYVADVTMTAVEMMSHAY 157
28 -14.1004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  10  27...........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVDDVERLIQITVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAF 150
29 -14.1004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  15  74...........TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSQALIAQ--QKQIGEIHARIKIPIHLVLRGARHLRERLVLLRQRPLDPEHKLFGQRLISELAMEIMSRAF 199
30 -13.3001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  13  10LVSSSFEAF--KANIPQYSVVFYTSILEAPAAKDLFSNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKK... 142
31 -13.2003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  11  8MIQKSWLRV--IDKMDEAGLLFYRRLFDEPKVRPLFKI-DIEKQGRKLMDVLNWIVLNLQDIDALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIEE.. 132
32 -13.0002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  12  50...........EDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPY 189
33 -12.9003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  12  9LIKESWKRI--EPNKNEIGLLFYANLFKEPTVSVLFQN-PISSQSRKLMQVLGILVQGIDNLEGIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMTAE.. 133
34 -11.6001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  18...........KEHGVTITTTFYKNLAKHPEVRPLFDRQESLEQPKALAMTVLAAAQNIENLPALPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDILDAWGKAYGVIADVFIQV.. 136
35 -11.6001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  9VVASTWKDIAGADNGAGVGKECLSKFSAHPEMAAVFGDPGVAELGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISG.. 144
36 -11.3001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  9VVASTWKDIAGSDNGAGVGKECFTKFSAHHDMAAVFGDPGVADLGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALIS... 143
37 -11.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  10LVKSSWEEF--NANIPKHTHRFFILVLEAPAAKDLFSNPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKE.. 148
38 -11.0001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  9VIAATWKDIAGADNGAGVGKKCLIKFSAHPQMAAVFGDPGVAALGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISG.. 144
39 -10.8001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  10YIKGVWKDVDHKQITAKALERVFV---VYPWTTRLFSDIGVQQHADKVQRALGEAIDDLKKVEI----QNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSN.. 139
40 -10.6001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  11  20LIRSTWDQL--MTHRTGFVADVFIRIHNDPTAQRKFPSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQVHDAWAKTFAIVQGVLITK.. 156
41 -10.5001gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  7.ERDEISKTFQGTDMKTVVTQALDRMKVYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDKTLFKDLSKKHADLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQ.. 134
42 -10.1001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  20IVRKTWHQL--MRNKTSFVTDVFIRIAYDPSAQNKFPSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVK.. 156
43 -10.0002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  11  9NVKAAWSKV--GGHAGEYGAEALERMLGFPTTKTYFPHFDLSHGSAQVKAHGKKVADGLTLAVGHLDDSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSK.. 139
44 -10.0001xz7_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  9NVKAAWGKV--GAHAGEYGAEALERMLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPSDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSK.. 139
45 -10.0003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  17LVVKSWAVM--KKNSAELGLKFFLKIEIAPSAKNLFSNPKLKPHAMTVFVMTCESAVQLRKAGK----KRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAIKSE.. 156
46 -9.9503mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  7.ERDEIVKTFFSANSSAIGTKALERMVVFPWTNAYFAKXXXFSASIHAAIVVGALQDAVKHEDDKAEFVNISKAHAKLHIDPGSFHLLTDSFIVELAHLKKVAFTPFVFAVWIKFFQVVIDAISSQ.. 134
47 -9.9403zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  16LVVKSWSVM--KKNSAELGLKLFIKIEIAPTTKKMFSNPKLKPHAMSVFVMCCESAVQLRKTGK----KRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEMKVAWGQAYDHLVAAIKA... 154
48 -9.7602wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  17...........QKNGEDLTNEFYKIMNDYPEVKPMFNMQISGEQPKALAMAILMAAKNIENLENRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNL---NPDEATLKAWEVAYGKIAKFYIDI.. 133
49 -9.7601g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  11  9NVKAAWSKV--GGHAGEYGAEALERMLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSK.. 139
50 -9.7604mpm_A mol:protein length:151 Neuroglobin  ali model follow..  8LIRQSWRAV--SRSPLEHGTVLFARLALEPDLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSR... 146
51 -9.7501oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  8LIRQSWRAV--SRSPLEHGTVLFARLALEPDLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPATRAAWSQLYGAVVQAMSR... 146
52 -9.7203cy5_A mol:protein length:141 Hemoglobin subunit alpha-2  ali model follow..  10  9NIQAAWGKV--GGHAADYGAEALERMLSFPTTKTYFPHFDLSHGSAQVKGHGAKVANALTKAVGHLDDSELSDLHAKLRVDPVNFKLLSHSLLVTLASHLPNDFTPAVHASLDKFLASVSTVLTSK.. 139
53 -9.6301kr7_A mol:protein length:110 Neural globin  ali model follow..  13  2............VNWAAVVDDFYQELKAHPEYQNKFGFKGVAKGNAAYKTQAGKTVDYINAAIGGSADAALASRHKGRNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDIL................ 107
54 -9.4702vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  11LIRQSWRVV--SRSPLEHGTVLFARLALEPSLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSS----TSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSR... 149
55 -9.4503qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  17LVVKAWAVM--KKNSAELGLQFFLKIEIAPSAKNLFSNPKLKPHATTVFVMTCESAVQLRKAGK----KRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGVAYDQLVAAIKFE.. 156
56 -9.3003dht_A mol:protein length:141 Hemoglobin subunit alpha-1/2  ali model follow..  9NIKNCWGKI--GGHGGEYGEEALQRMAAFPTTKTYFSHIDVSPGSAQVKAHGKKVADALAKAADHVEDSTLSDLHAKLRVDPVNFKFLSHCLLVTLACHHPGDFTPAMHASLDKFLASVSTVLTSK.. 139
57 -9.2601y09_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  9NVKAAWGKV--GAHAGEYGAEALERMLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPSDLHAHKLRVDPVAFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSK.. 139
58 -9.1904u8u_D mol:protein length:141 Globin d Chain  ali model follow..  10  10VKNQWREAFGEGHHRVQFGLELWKRFDTHPEVKGLFKSPEFAAHAERVLSGLDMTIGLLDDTNA----THLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQDAWTKCFHTIADG......... 138
59 -9.1801fhj_A mol:protein length:141 HEMOGLOBIN (ALPHA CHAIN)  ali model follow..  9NIKSTWDKI--GGHAGDYGGEALDRTQSFPTTKTYFPHFDLSPGSAQVKAHGKKVADALTTAVAHLDDLP-DLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPAVHASLDKFFTAVSTVLTSK.. 139
60 -9.1604u8u_B mol:protein length:142 Globin b Chain  ali model follow..  11VKAQWRRAYSHGHNREDFAQAIWRALAQVPDSRTLFKSPEFQAHALRVLAGFDIAISTLDQPDA----DHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKDAWSACFDHIAHG......... 139
61 -9.1501xzv_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  9NVKAAWGKV--GAHAGEYGAEALERMLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMP-DLHAHKLRVDAVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSK.. 139
62 -9.1503wtg_A mol:protein length:142 Hemoglobin subunit alpha-A  ali model follow..  11  10NTKSVFAKI--GPHAEEYGAETLERLTTYPQTKTYFPHFDLHHGSAQVKAHGKKVAAALVEAANHIDDISSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSLLTPEVHASLDKFLCAVANVLTAK.. 140
63 -9.1501o1o_A mol:protein length:141 Hemoglobin Alpha chain  ali model follow..  11  9NVKAAWGKV--GAHAGEYGAEALERMLSFPTTKTYFPHFDLSHGSAQVKGHGKKLADALTNAVAHVDDSALSDLHAKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSK.. 139
64 -9.1401hds_A mol:protein length:141 HEMOGLOBIN S (DEOXY) (ALPHA CHAIN)  ali model follow..  11  9NVKAAWGKV--GGNAPAYGAQALQRMLSFPTTKTYFPHFDLSHGSAQQKAHGQKVANALTKAQGHLNDSNLSNLHAKLRVNPVNFKLLSHSLLVTLASHLPTNFTPAVHANLNKFLANDSTVLTSK.. 139
65 -9.1303gdj_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  11  9NVKTAFGKI--GGHAAEYGAEALERMLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTKAADHLDDSALSDLHAKLRVDPVNFKLLSHCLLVTVAAHHPGDFTPSVHASLDKFLANVSTVLTSK.. 139
66 -9.1103at5_B mol:protein length:146 Beta-globin  ali model follow..  10FIVNLWGRVDVEQIGAEALARLLI---VYPWTQRFFSNAKVHAHGKKVLTSFGEAVKNLDQ-IKQTFAQLSELHSDKLHVDPENFKLLGNILIIVLAAHFGKDFTPASQAAWQKLVSAVAHALALR.. 144
67 -9.0803fh9_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  13  9NVKAAWDKV--GGNVGEYGAEALERMLSFPTTKTYFPHFDLAHGSSQVKAHGKKVGDALTNAVGHIDDSALSDLHAKLRVDPVNFKLLSHCLLVTLASHLPSDFTPAVHASLDKFLASVSTVLTSK.. 139
68 -9.0801s0h_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  11  9NVKAAWSKV--GGNAGEFGAEALERMLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDSNLSDLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSK.. 139
69 -9.0804yu3_A mol:protein length:141 hemoglobin  ali model follow..  9NIKASWEKI--GSHGGEYGAEALERTLCFPTTKTYFPHFDLSHGSAQVKAHGKKVADALTNAVGHLDDLP-DLHAYKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFLSSVSTVLTSK.. 139
70 -9.0801faw_A mol:protein length:141 HEMOGLOBIN (ALPHA SUBUNIT)  ali model follow..  10  9NVKGVFSKI--GGHAEEYGAETLERMTAYPQTKTYFPHFDLQHGSAQIKAHGKKVAAALVEAVNHIDDIA-DLHAQKLRVDPVNFKFLGHCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAK.. 139
71 -9.0502qmb_A mol:protein length:142 Hemoglobin subunit alpha-A  ali model follow..  13  10NVKGIFTKI--AGHAEEYGAETLERMITYPPTKTYFPHFDLSHGSAQIKGHGKKVVAALIEAANHIDDSKLSDLHAKLRVDPVNFKLLGQCFLVVVAIHHPAALTPEVHASLDKFLCAVGTVLTAK.. 140
72 -9.0305eui_A mol:protein length:141 HBA protein  ali model follow..  9NVKAAWGKV--GGHAGEYGAEALDRMLSFPTTKTYFPHFDMSHGSAQVKAHGKKVADALTQAVDHLDDLP-DLHAHKLRVDPVNFKLLAHCLLVTLANHHPNEFTPAVHASLDKFLASVSTVLTSK.. 139
73 -9.0201a4f_A mol:protein length:141 HEMOGLOBIN (ALPHA CHAIN)  ali model follow..  12  9NVKGVFSKI--SGHAEEYGAETLERMTAYPQTKTYFPHFDLQHGSAQIKAHGKKVVAALVEAVNHIDDSKLSDLHAKLRVDPVNFKFLGHCFLVVVAIHHPSALTAEVHASLDKFLCAVGTVLTAK.. 139
74 -9.0202zfb_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  15  9NVKSIFSKI--GGQADDYGAEALERMVTYPQTKTYFPHFDVSPGSAQVKAHGKKVAGGLSEAANHIDDSKLSDLHAKLRVDPVNFKLLGQCFLVVVAIHNPSALTPEAHASLDKFLCAVGLVLTAK.. 139

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.