current user: public

If you have questions about the server, please let us know.

Query: 1nyt_A mol:protein length:271 Shikimate 5-dehydrogenase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst METYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTLMRLEDGRLLGDNTDGVGLLSDLERLSFIRPGLRILLIGAGGASRGVLLPLLSLDCAVTITNRTVSRAEELAKLFAHTGSIQALSMDELEGHEFDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNADGLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEELSLast
1 -108.0001nyt_A mol:protein length:271 Shikimate 5-dehydrogenase  ali model  100  1METYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANVTVPFKEEAFARADELTERAALAGAVNTLMRLEDGRLLGDNTDGVGLLSDLERLSFIRPGLRILLIGAGGASRGVLLPLLSLDCAVTITNRTVSRAEELAKLFAHTGSIQALSMDELEGHEFDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNADGLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEELS 271
2 -105.0001p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  48  1MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSAGLSGGTASVDAEILKLGSAFYDMQYKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAM. 271
3 -99.3003pwz_A mol:protein length:272 Shikimate dehydrogenase 3  ali model follow..  44  2SDRYAVIGRPINHTKSPLIHGLFAQASNQQLEYGAIEGSLDDFEAQVLQFRSEGGKGMNITAPFKLRAFELADRRSERAQLARAANALKF-EDGRIVAENFDGIGLLRDIEELGEPLRNRRVLLLGAGGAVRGALLPFLQAGPELVIANRDMAKALALRNELDH-SRLRISRYEALEGQSFDIVVNATSASLTADLPPLPADVLGEAALAYELAYGKGLTPFLRLAREQGQARLADGVGMLVEQAAEAFAWWRGVRPDTRAVINQLTIPLE 272
4 -98.6003pgj_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  50  23IDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDLLAQQVLLKGATILLIGAGGAARGVLKPLLDQQPSITVTNRTFAKAEQLAELVAAYGEVKAQAFEQL-KQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQAIDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNLE 293
5 -97.0004omu_A mol:protein length:283 Shikimate dehydrogenase  ali model follow..  49  1MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQG-SGGNVTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVAGVELAGKRILILGAGGAVRGVLEPILAHKPSLVIANRTVEKAEQLAREFDELGPVVASGFAWL-QEPVDVIINATSASLAGELPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLA 272
6 -92.0001wxd_A mol:protein length:263 shikimate 5-dehydrogenase  ali model follow..  34  1MLRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRR-AFRGVNLTLPLKEAALAHLDWVSPEAQRIGAVNTVLQ-VEGRLFGFNTDAPGFLEALKAGGIPLKG-PALVLGAGGAGRAVAFALREAGLEVWVWNRTPQRALALAEEFGLRA------VPLEKAREARLLVNATRVGLEDSASPLPAELFPEEGAAVDLVYRPLWTRFLREAKAKGLK-VQTGLPMLAWQGALAFRLWTGLLPDPSGMEEAARRALG 262
7 -91.3002hk9_A mol:protein length:275 Shikimate dehydrogenase  ali model follow..  30  7.QLYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTVPFKEEIIPLLDYVEDTAKEIGAVNTVKF-ENGKAYGYNTDWIGFLKSLKSLIPEVKEKSILVLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFP----LEVVNSPEEVIDKVQVIVNTTSVGLKDEPEIFNYDLIKKDHVVVDIIYKE--TKLLKKAKEKGAK-LLDGLPMLLWQGIEAFKIWNGCEVPYSVAERSVRDLR. 268
8 -91.0001nvt_A mol:protein length:287 Shikimate 5`-dehydrogenase  ali model follow..  30  12.KVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKI-EDGKAIGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAKDN-NIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSLDGVDIIINATPIGMYPNEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAK-TINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKIT 286
9 -90.8003don_A mol:protein length:277 Shikimate dehydrogenase  ali model follow..  35  2..KFAVIGNPISHSLSPLMHHANFQSLNLENTYEAINVPVNQFQDIKKIISEKSIDGFNVTIPHKERIIPYLDDINEQAKSVGAVNTVLV-KDGKWIGYNTDGIGYVNGLKQIYEGIEDAYILILGAGGASKGIANELYKIVRTLTVANRTMSRFNNWSLNIN----KINLSHAESHLDEFDIIINTTPAGMNGNTSVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNP-IYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLK 266
10 -90.5002egg_A mol:protein length:297 Shikimate 5-dehydrogenase  ali model follow..  34  18.KVYGLIGFPVEHSLSPLMHNDAFARLGIPARYHLFSVEPGQVGAAIAGVRALGIAGVNVTIPHKLAVIPFLDEVDEHARRIGAVNTIIN-NDGRLVGYNTDGLGYVQALEEMNITLDGKRILVIGAGGGARGIYFSLLSTAARIDMANRTVEKAERLVREGDERSAYFSLAEAETRLAEYDIIINTTSVGMHPEVQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARGAR-VQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALR 290
11 -90.4003fbt_A mol:protein length:282 chorismate mutase and shikimate 5-dehydrogenase fusion protein  ali model follow..  27  6.SIYGLIGEKLGHSHSSYIHKLIFEKVGIKGIYNLFEVPKEKLKESVDTFKIIKCGGLNVTIPYKVEVMKELYEISEKARKIGAVNTLKF-SREGISGFNTDYIGFGKMLSKFRVEIKNNICVVLGSGGAARAVLQYLKDNFADIYVVTRNPEKTSEIYGEFK------VISYDELSNLKGDVIINCTPKGMYPGESPVDKEVVAKFSSAVDLIYNPVETLFLKYARESGVK-AVNGLYMLVSQAAASEEIWNDISIDEIIVDEIFEVLEE 270
12 -90.1005dzs_A mol:protein length:276 Shikimate dehydrogenase (NADP(+))  ali model follow..  29  1MNFFGLVGEKLSHSVSPQIHKRVFEILNIESAYKNFEISKEDISKLDGAIKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTILL-RENMLYGYNTDYFGLDSMFKMANIDVQGKVAVILGTGGASKAALTYFIDSGIKLYVSTRKKDDKKLLNSKAI------LIDYEELKHIKGDIILNATPVGMYPGISPVSKSIIQNFDILIDLIYNPGETEFLRIGNSMGKK-TCDGLYMLVGQAIKSQEIWQDTKIDNSILDVIYNELKL 266
13 -90.0001vi2_A mol:protein length:300 Shikimate 5-dehydrogenase 2  ali model follow..  27  10.ELIGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVDNDSFPGAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVN-DDGYLRGYNTDGTGHIRAIKESGFDIKGKTMVLLGAGGASTAIGAQGAIEGLEIKLFNRRDEKALAFAQRVNENTDCVVTVTDAEALASADILTNGTKVGMKPESLVNDISLLHPGLLVTECVYNPHMTKLLQQAQQAGCK-TIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGFGAE 291
14 -88.0003tnl_A mol:protein length:315 Shikimate dehydrogenase  ali model follow..  26  32.ELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVN-DDGVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVEISIFNRKDDFYANAEKTVEKINSKTDCKAQRKEIAESVIFTNATGVGMKPETLLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQ-TLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEIL..... 308
15 -87.9003t4e_A mol:protein length:312 Quinate/shikimate dehydrogenase  ali model follow..  26  26.ELIGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVN-DDGYLRGYNTDGTGHIRAIKESGFDMRGKTMVLLGAGGAATAIGAQAAIEGIEIKLFNRKFEKAVAFAKRVNENTDCVVTVTDTEALASADILTNGTKVGMKPESLIGDVSLLRPELLVTECVYNPHMTKLLQQAQQAGCK-TIDGYGMLLWQGAEQFELWTGKAFPLDYVKQVMGFT.. 305
16 -86.6002nlo_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  25  18.ILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVIDATGHTTGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGVKLQVADLDTSRAQALADVINNAVGREAVVGVDARIAAADGVVNATPMGMPAHPTAFDVSCLTKDHWVGDVVYMPIETELLKAARALGCE-TLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLS... 295
17 -85.1004foo_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  30  3LKSFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPLPLESHIKSEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECGAVNTLVL-ENDELVGYNTDALGFYLSLKQ----KNYQNALILGAGGSAKALACELKKQGLQVSVLNRSSRGLDFFQRLGCD-------CFMEPPKSAFDLIINATSASLHNELKEVLKGYFKEGKLAYDLAYGF-LTPFLSLAKELKTP-FQDGKDMLIYKAALSFEKFSASQIPYSKAFEVMRSVFL 264
18 -84.7001npy_A mol:protein length:271 Hypothetical shikimate 5-dehydrogenase-like protein HI0607  ali model follow..  22  9..CMSLSGRP--SNFGTTFHNYLYDKLGLNFIYKAFTT--QDIEHAIKGVRALGIRGCAVSMPFKETCMPFLDEIHPSAQAIESVNTIVN-DNGFLRAYNTDYIAIVKLIEK-YHLNKNAKVIVHGSGGMAKAVVAAFKNSGFKLKIYARNVKTGQYLAALYGYA------YINSLENQQADILVNVTSIGMKGGKLAFPKAFIDNASVAFDVVAMPVETPFIRYAQARGKQ-TISGAAVIVLQAVEQFELYTHQRPSDELIAEAAAFART 269
19 -84.5004fsh_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  30  3LKSFGVFGNPIKHSKSPLIHNACFKKLGFLGHYRPILLPLES--HIKNEFLHLGLSGANVTLPFKERAFQVCDKIKGIALECASINTLVL-ENDELVGYNTDALGFYLSLKH----QNYQNALILGSGGSAKALACGLKKQGLKVSVLNRSPRGLDFFQRLGCD-------CFMEPPKSAFDLIINATSASLNNELPEVLKGYFKEAKLAYDLAYGF-LTPFLALAKELKIP-FQDGKDMLIYQASLSFEKFSASQIPYSKAFEVMRSVFL 264
20 -83.9003u62_A mol:protein length:253 Shikimate dehydrogenase  ali model follow..  26  2..KFCIIGYPVRHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILE-EYDGFNATIPHKERVMRYVEP-SEDAQRIKAVNCVF-----RGKGYNTDWVGVVKSLEG---VEVKEPVVVVGAGGAARAVIYALLQMGVDIWVVNRTIERAKALDFPVK----IFSLDQLDEVVKKAKSLFNTTSVGMKGEELPVSDDSLKNLSLVYDVIYFD--TPLVVKARKLGVKHIIKGNLMFYYQAMENLKIWGIYDEEV--FKEVFGEVLK 253
21 -81.9004k28_A mol:protein length:269 Shikimate dehydrogenase family protein  ali model follow..  28  7.ELVAIVGSPIAQVKSPQNFNTWFNHNNCNLAMLPIDLHEAALDSFADTLRGWNLRGCVVTVPYKQALANRVDGLSERAAALGSINVIRRERDGRLLGDNVDGAGFLGAAHKHGFEPAGKRALVIGCGGVGSAIAYALAEAGISITLCDPSTARMGAVCELLGNGFPGLTVSTQFSGLEDFDLVANASPVGMGTRLSAALLATLQPDTLVADVVTSPEITPLLNRARQVGCR-IQTGPEMAFAQLG-HLGAFMGVTPL............. 267
22 -79.4004p4g_A mol:protein length:277 Shikimate 5-dehydrogenase AroE (5-dehydroshikimate reductase)  ali model follow..  24  6.KKAGVLGSPIAHSRSPQLHLAAYRALGLDWTYERIECGAAELPVVVGGFGP-EWVGVSVTMPGKFAALRFADERTARADLVGSANTLVR-TPHGWRADNTDIDGVAGALGA-----AAGHALVLGSGGTAPAAVVGLAELGVDITVVARNSDKAARLVDLGTRVGVATRFCAFDSGVAAAEVLVSTIPAEVAAG----YAGTLAAIPVLLDAIYDPWPTPLAAAVGSAGGR-VISGLQMLLHQAFAQVEQFTGLPAPREAMTCALAALDL 270
23 -78.9004xij_A mol:protein length:275 Shikimate 5-dehydrogenase  ali model follow..  26  8.RKAAVLGSPITHSRSPQLHLAAYRALGLPWTYERIECTAEQLPGLVSALGP-EWVGLSVTMPGKFAALEFADQRTDRAQLVGSANTLVRMPTGGWRADNTDVDGVTGALGT-----AGDSALVIGSGGTAPAAVVALAELGVRITIVARDEGKASRLVDLARRCGAQGGWAALADAVASADAAVSTIPADAA----AVYADALARVPRVLDAIYDPWPTPLAQAVEAAGGE-AINGLQMLLNQAFAQVEQFTGMPAPKEAMRAAL..... 268
24 -75.7002gpt_A mol:protein length:523 3-dehydroquinate dehydratase/ shikimate 5-dehydrogenase  ali model follow..  29  234TKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLV--DNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRKSDGKLLGYNTDCIGSISAIEDGSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKA-LSLTDLDNYHPEDGMVLANTTSMGMQPEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAI-TVSGSEMFVRQAYEQFEIFTGLPAPKELYWQIMSKYGS 516
25 -72.5005swv_C mol:protein length:531 Pentafunctional AROM polypeptide  ali model follow..  26  252.EKFFLFGKPIKHSRSPILHSTAYELLGLPHTYEAFET--DTVDEVQKVLNLPDFGGANVTIPYKLSVMKFMDELSDEARFFGAVNTIIPIDKLVLRGDNTDWRGIYDTFANAGVSLRDTNGLVIGAGGTSRAAIYSLHRLGVRIYLLNRTLANSYRVQDVFPPDYNIHIIDSDNIPSVTLSAVVSTIPADIELPEKVASVANKADGGVFLDMAYKPLHTPLMAVASDLEWK-CCNGLEALVRQGLASFHLWTGMTAPFDAVYQKVIE... 531
26 -36.1004q39_A mol:protein length:260 PYLD, pyrrolysine synthase  ali model follow..  11  15.MQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVGIVPGNFSASLHAI--TQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDRTFLAKNGKMANNQPGIIYAEIASRY-LKADSKDVLVVGLGKVGFPGAEHLVQKDFRVYGYDADETLLERATSNLGIIPFD------PANPKKFSIIFEATPCA-----NTIPEAVLSENCVLSTPGIPCAISE--ELRDKYEVQLIAEGTASMLYSVL......................... 260
27 -17.8003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  22  2...................................................................................................NAGKVSIPSIVYDIVRKNGGNKILLVGNGMLASEIAPYFSYPQYKVTVAGRNIDHVRAFAEKYE--YEYVLINDIDSLIKNNDVIITATSS----KTPIVEERSLMPGKLFIDL.......................................................... 109
28 -12.9003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  17  4.....................................................................................................................MRWNICVVGAGKIGQMIAALLKTSSYSVTVADHDLAALAVLNRMGVATKQVDAKDEAGLALGGFDAVISAAPFFLT---PIIAKAAKAAGAHYFDLTEDVAATNAVRALVEDS......................................... 116
29 -12.8004n7r_A mol:protein length:472 Glutamyl-tRNA reductase 1, chloroplastic  ali model follow..  14  86............HRGVKEVTEWMSKTSGIPVSEICQHRFLLYNKDATQHIFEVS-AGLDSLVLGEGQILAQVKQVVKVGQGVNGFGRNISGTVGKRVRTETNIASGAVSVSSAAVELVSARMCVIGAGKMGKLVIKHLMAKGCKVVVVNRSEERVSAIREEMPGI-EIIYRPLDEMLASEADVVFTSTASE---ENLPQASPEVGGLRHFVDIVYNVDDLKEVVAANKEDRMRKAMEAQTIITEESTQFEAWRDSLETVPTIKK....... 377
30 -12.8001gpj_A mol:protein length:404 GLUTAMYL-TRNA REDUCTASE  ali model follow..  17  51VEVYASGARDRAEELGDLIHDDAWVKRGSEAVRHLFRVA----------------SGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKINLGKRAREETRGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVDRGVAVLVANRTYERAVELARDLG--GEAVRFDELVDHLARSDVVVSATAIHVDDVREALRKRDRRSPILIIDIVRTIDDLRVIARENLERRRKEIPKVEKLIEEELSTVEEELEKLKERRLVAD....... 333
31 -12.6001e5l_A mol:protein length:450 SACCHAROPINE REDUCTASE  ali model follow..  17  1....................................................................................................................MATKSVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALAKHDLVISLIPYTFH---ATVIKSAIRQKKHVVTTSYVSPAMMELQAAKDAGITVMNEGIHLYAIKTIEEVH..................... 142
32 -12.5005l76_A mol:protein length:497 Alpha-aminoadipic semialdehyde synthase, mitochondrial  ali model follow..  16  8...................................................................................LGTENLYFQSMAL----PDKYKYIQTLRESRERAQSRKVLVLGSGYISEPVLEYLSRDGIEITVGSDMKNQIEQLGKKYNINPVSMDICKQEEKLAKQDLVISLLPYVLH---PLVAKACITNKVNMVTASYITPALKELKSVEDAGITIIGEGLHMLAMESIDKAK..................... 185
33 -12.1003abi_A mol:protein length:365 Putative uncharacterized protein PH1688  ali model follow..  15  1.............................................................................................................MNHKVIEGRHMKVLILGAGNIGRAIAWDLKDEF-DVYIGDVNNENLEKVKEFATPKVDASNFDKLVEVMKEFELVIGALPGFLG---FKSIKAAIKSKVDMVDVSFMPENPLELDEAEKAQVTIVFDGLNILMGRIFQELD..................... 145
34 -11.3001lu9_A mol:protein length:287 Methylene Tetrahydromethanopterin Dehydrogenase  ali model follow..  10  4..........LLFQFDTDATPSVFDDGGADHITGYGNVTPDNVGAYVDGIYTRGGKEKQSTAIF-AAGERVFEAVKKRFFGPFRVSCMLDSNG----SNTTAAAGVALVVKAAGGSVKGKKAVVLAGGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAADSVNKRFKVNVTAAEAEAVKGAHFVFTAGAIGLE.............................................................................. 201
35 -11.2004b4u_A mol:protein length:303 BIFUNCTIONAL PROTEIN FOLD  ali model follow..  15  54.....LVGDDGASATYVRMKGNACRRVGMDSLKIELETTTEQLLAEIEKLNAPDVHGILLQHPVPAQIDE--RACFDAISLAKDVDGVTCLGFGRMAMGEATPAGIMTILKENNIEIAGKHAVVVGRSALGKPMAMMLLQANATVTICHSRTQNLPELVK-------------------QADIIVGAV-----GKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASGVGTLIRQTVEAAEKALG................. 297
36 -11.1002axq_A mol:protein length:467 Saccharopine dehydrogenase  ali model follow..  18  1..........................................................................................................MGSSGHIEGRHMGKNVLLLGSGFVAQPVIDTLAANDINVTVACRTLANAQALAKPSGSKADVTDDSALDKVLADNDVVISLIPYTFH---PNVVKSAIRTKTDVVTSSYISPALRELPEIVKAGITVMNEGIHLYAVKTIDEVH..................... 152
37 -11.0003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  16  142.........................................................................................................IMMAIQHTDFTIHGANVAVLGLGRVGMSVARKFAALGAKVKVGARESDLLARIAEMGMEPFHISKA---AQELRDVDVCINTIPALVVTANV---LAEMPSHTFVIDLASKPGGTDFRYAEKRGIKALLVPGLPGIVAPKTAG-----------RILADVLVKLLA 290
38 -10.9002qq5_A mol:protein length:260 Dehydrogenase/reductase SDR family member 1  ali model follow..  15  2...................................................................................................................PMNGQVCVVTGASGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPG-VPYGVGKAACDKLAADCAHELR 180
39 -10.8003l07_A mol:protein length:285 Bifunctional protein folD  ali model follow..  13  41.....IVGNDPASKTYVASKEKACAQVGIDSQVITLHTTESELLELIDQLNNSSVHAILVQLPLPAHINK--NNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLGIMTMLREYGIKTEGAYAVVVGASNVGKPVSQLLLNAKATVTTCHRFTTDLKSHTT-------------------KADILIVAV-----GKPNFITADMVKEGAVVIDVGINHVDGKIVGDVDFAAVKDKVAGVGELLYNTFQCAQ..................... 281
40 -10.7001lss_A mol:protein length:140 Trk system potassium uptake protein trkA homolog  ali model follow..  10  3.....................................................................................................................HGMYIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVCTKIKTLEDAGIEDADMYIAVTG----KEEVNLMSSLLAKSYGINKTIARISEIEYKDVFERLGVDVVVSPELIAANY........................... 129
41 -10.6002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  14  144.........................................................................................................IMLAIQHTDYTIHGSQVAVLGLGRTGMTIARTFAALGANVKVGARSSAHLARITEMGLVPFHTDEL---KEHVKDIDICINTIPSMILNQTV---LSSMTPKTLILDLASRP...................................................... 249
42 -10.5002nwq_A mol:protein length:272 Probable short-chain dehydrogenase  ali model follow..  13  1........................................................................................................GSSSSGLVPRGSHMSSTLFITGATGFGEACARRFAEAGWSLVLTGRREERLQALAGELSAKTRVLPLTLDVRDRAAMRGLIN--NAGLALGTDPAQSCDLDDWDTMVDTLLYSTRLLLPRLIAHGAGASIVNLGSVAGKWPYPGSHVYGGTKAFVEQFSLNLRCDLQ 184
43 -10.5003guy_A mol:protein length:230 Short-chain dehydrogenase/reductase SDR  ali model follow..  13  2.......................................................................................................................SLIVITGASGLGAELAKLYDAEGKATYLTGRSESKLSTVTNCLSNNVGYRARDLASHQESIPSTVVHSAGSGYFGLLQEQDPEQIQT-LIENNLSSAINVLRELVKRYKDQPVNVVMIMSTAAQQPKAQESTYCAVKWAVKGLIESVRLELK 162
44 -10.5004ina_A mol:protein length:405 saccharopine dehydrogenase  ali model follow..  19  2.......................................................................................................................AKVLQIGAGGVGGVVAHKMAMNRSHITLASRTLSKCQEIAQSIKAKGYGEIDITALINEVKPQIVLNIALPYQD---LTIMEACLRTGVPYLDTFEYKEQWAFHDRYKEKGVMALLGGVNVFCAYAQKHYF..................... 159
45 -10.5001xg5_A mol:protein length:279 ARPG836  ali model follow..  16  23...................................................................................................................RWRDRLALVTGASGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGY-SMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSMFNVNVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELR 200
46 -10.4005vps_A mol:protein length:267 Short-chain dehydrogenase/reductase SDR  ali model follow..  15  2...............................................................................................................AMDLGIAGKTALVCAASGLGRGCAEALAAEGVNLVIVARTRDTLEETAEEIRAASNVSVTAVACAACPQPDILVNNAGGPPPGDFRDFSHDDWIRALEANMLTPIELIRATVDGMIGRGFGRIVNITSSAVKAPIDVLALSNGARSGLTGFVAGLSRKVA 174
47 -10.4001o5i_A mol:protein length:249 3-oxoacyl-(acyl carrier protein) reductase  ali model follow..  13  1..........................................................................................................MGSDKIMELGIRDKGVLVLAASGIGRAVADVLSQEGAEVTICARNEELLKRSGHRYVVCDLRKDLDLLFEKVKEVDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVA 166
48 -10.4003l6e_A mol:protein length:235 Oxidoreductase, short-chain dehydrogenase/reductase family  ali model follow..  14  1....................................................................................................................MSLGHIIVTGAGGLGRALTIGLVERGHQVSMMGRRYQRLQQQELLLGNAVIGIVADLAHHEDVDPELVLHCAGTGEFGPVGVYTAEQIRR-VMESNLVSTILVAQQTVRLIGERGGVLANVLSSAAQVGKANESLYCASKWGMRGFLESLRAELK 167
49 -10.4003h7a_A mol:protein length:252 short chain dehydrogenase  ali model follow..  13  1................................................................................................................MSLTPRNATVAVIGAGYIGAEIAKKFAAEGFTVFAGRRNGEKLAPLVAEIEAAGEVTAFLNAADAHAPLEVTIFNVGANVNFPILETTDR--------FRKVWEMACWAGFVSGRESARLMLAHGQGKIFFTGATAFAAFASAKFGLRAVAQSMARELM 174
50 -10.4005idx_A mol:protein length:267 Short-chain dehydrogenase/reductase SDR  ali model follow..  14  2...............................................................................................................AMDLGIAGKTALVCAASGLGRGCAEALAAEGVNLVIVARTRDTLERTADEIRAASNVSVATVACAACPQPDILVNNAGGPPPGDFRDFSHDDWIRALESNMLTPIELIRATVDGMIARGFGRIVNITSSAVKAPIDVLALSNGARSGLTGFVAGLARKVV 174
51 -10.3005va8_A mol:protein length:267 Short-chain dehydrogenase/reductase SDR  ali model follow..  15  3................................................................................................................MDLGIAGKSALVCAASGLGRGCAEALAAEGVNVTIVARTPETLDATAAAIRANAGVDVQAVA-AACPQPDILVNNAGGPPPGDFRNFTHDDWIRALEANMLTPIELIRATIDGMISRGFGRVVNITSSSVKAPIDVLGLSNGARSGLTGFIAGVARKVA 174
52 -10.3002ehd_A mol:protein length:234 Oxidoreductase, short-chain dehydrogenase/reductase family  ali model follow..  12  1..................................................................................................................MEGMKGAVLITGASGIGEATARLLHAKGYRVGLMARDEKRLQALAAELEGALPLPGDVREEGDWARASALVNNAGVGVMKPVHELTLE--------WRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSLA-AAYNASKFGLLGLAGAAMLDLR 169
53 -10.2003p19_A mol:protein length:266 Putative blue fluorescent protein  ali model follow..  12  4..........................................................................................................MTGGQQMGRGSMKKLVVITGASGIGEAIARRFSEEGHPLLLLARRVERLKALNLPNTLCAQVDVTDKYTFDTGPADAIVNNAGMMLLGQIDTQEANEWQRMFDVNVLGLLNGMQAVLAPMKARNCGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEVA 178
54 -10.1001dia_A mol:protein length:306 METHYLENETETRAHYDROFOLATE DEHYDROGENASE/CYCLOHYDROLASE  ali model follow..  14  42.....QVGNRDDSNLYINVKLKAAEEIGIKATHIKLTTTESEVMKYITSLNESTVHGFLVQLPLDSENSINTEEVINAIAPEKDVDGLTSINAGRLARGDLN-KGCLELIKETGVPIAGRHAVVVGRSKVGAPMHDLLLWNNATVTTCHSKTAHLDEEVN-------------------KGDILVVAT-----GQPEMVKGEWIKPGAIVIDCGINYVDVAYDEAKERASFITPVPGVAMLMQSTVESAK..................... 292
55 -10.0005fyd_A mol:protein length:263 OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY PROTEIN  ali model follow..  12  8......................................................................................................................GEWGLILGAEGVGKAFCEKIAAGGMNVVMVGRREEKLNVLAGEIRETYGVETKVVAATEGLDMGFMSYVACLHSFGKIQDTPWEKHEAMINVNVVTFLKCFHHYMRIFAAQDRGAVINVSSMTGISSSPWNGQYGAGKAFILKMTEAVACECE 175
56 -10.0005jo9_A mol:protein length:242 Ribitol 2-dehydrogenase  ali model follow..  10  4...................................................................................................................ELEGKVAAVTGAAGIGLASAEAMLAAGARVVMVDRDEAALKALCNKHGDTVIPLVVDLLDPEDCQLDILHANAGTYVGGDLVDADTM--------IDRMLNLNVNVVMKNVHDVLPHMIERRTGDIIVTSSLA-PVYASSKWAINCFVQTVRRQVF 172
57 -10.0004oqy_A mol:protein length:290 (S)-imine reductase  ali model follow..  17  1....................................................................................................................MSKQSVTVIGLGPMGQAMVNTFLDNGHEVTVWNRTASKAEALVAR-----GAVLAPTVEDALSANELIVLSLTDYDAVYAILEPVTGSLSGKVIANL-----SSDTPDKAREAAKWAAKHGAKHL.............................. 115
58 -10.0004yte_A mol:protein length:194 H(2)-forming methylenetetrahydromethanopterin dehydrogenase-related protein MJ0715  ali model follow..  11  7......................................................................................................GAGNQRLYLEQ------KVPEKFGGEYGGAGMAIEFAKAGHDVVLSEPNRDVMSDDLWKKVEDAGVKVVSDDIEAAKHGEIHVLFTPFGITLNIANTIIEHVPENAIICNT--CTIPTPVLYRSLEGILRLKRRDVGIS.............................. 141
59 -10.0003dtt_A mol:protein length:245 NADP oxidoreductase  ali model follow..  19  1..........................................................................................................MGSDKIENLYFQGMKIAVLGTGTVGRTMAGALADLGHEVTIGTRDPKATLARAEPDAMGAPPVHLAAFADVAAGAELVVNATEGASSIAALTAAGAENLAGKILVDIA......................................................... 118
60 -9.9904bmv_A mol:protein length:262 SHORT-CHAIN DEHYDROGENASE  ali model follow..  14  3.....................................................................................................................TLPTVLITGASGIGATYAERFARRGHDLVLVARDKVRLDALAARLRDESGVAVEALQAREDARIGILINNAGMAQSGGFVQQTAEGIERLITLNTTALTRLAAAVAPRFVQSGTGAIVNIGSVVGFAPEFGMSIYGATKAFVLFLSQGLNLELS 172
61 -9.8605g6r_A mol:protein length:295 IMINE REDUCTASE  ali model follow..  14  2......................................................................................................................SKHIGIFGLGAMGTALAAKYLEHGYKTSVWNRTTAKAIPLVEQ-----GAKLASTISEGVNANDLIIICLLNNQVVEDALRDALQTLPSKTIVNL-----TNGTPNQARKLADFVTSHGARYI.............................. 114
62 -9.8605o22_A mol:protein length:289 Bifunctional protein FolD  ali model follow..  16  41.....LVGSNPASQIYVASKRKACEEVGFVSRSYDLTTSEAELLELIDTLNANTIDGILVQLPLPAGIDN--VKVLERIHPDKDVDGFHPYNVGRLCQRAPTPRGIVTLLERYNIDTFGLNAVVIGASNVGRPMSMELLLAGCTTTVTHRFTKNLRHHVE-------------------NADLLIVAV-----GKPGFIPGDWIKEGAIVIDVGINRLENGKV-AKRASYITPVPGGVGTLIENTLQACVEYHDPQDE............. 289
63 -9.8503u49_A mol:protein length:281 Bacilysin biosynthesis oxidoreductase ywfH  ali model follow..  13  6...........................................................................................................SGLVPRGSHMSKRTAFVMGASGIGKAIALKLADQHFSLVINSRNLDNIESVKEDILAKHP-GIFQKIESQCGRLDVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDAIKRASSLMKQNEFGRIINIVGNLWKEPGANMFTNSMMNAALINASKNISIQLA 187
64 -9.8304rl6_A mol:protein length:427 Saccharopine dehydrogenase  ali model follow..  16  2.......................................................................................................................SRLLVIGCGGVAQVAISKICQDSTEIMIASRTKSKCDDLKAKLEGKTSTKIETAALIGSYKPEAVLNVALPYQD---LTIMDACLATGVHYIDTFDYSWQWAYQEKFKEAGLTALLGGVSVFSAYALKHYF..................... 178
65 -9.8303p2o_A mol:protein length:285 Bifunctional protein folD  ali model follow..  15  40.....LVGDNPASQTYVKSKAKACEECGIKSLVYHLNITQNELLALINTLNHDSVHGILVQLPLPDHICK--DLILESIISSKDVDGFHPINVGYLNLGLESGFGVMKLLKAYEIDLEGKDAVIIGASNVGRPMATMLLNAGATVSVCHIKTKDLSLYTR-------------------QADLIIVAA-----GCVNLLRSDMVKEGVIVVDVGINRLESGKI-SKKSSYITPVPGGVGMLLENTVKSAKNRLN................. 285
66 -9.7605ocm_A mol:protein length:291 NAD_Gly3P_dh, NAD-dependent glycerol-3-phosphate dehydrogenase  ali model follow..  14  1....................................................................................................................MRDTDVTVLGLGLMGQALAGAFLKDGHATTVWNRSEGKAGQLAEQ-----GAVLASSARDAAEASPLVVVCVSDHAAVRAVLDPLGDVLAGRVLVNL-----TSGTSEQARATAEWAAERGITYL.............................. 115
67 -9.7501cyd_A mol:protein length:244 CARBONYL REDUCTASE  ali model follow..  16  1................................................................................................................MKLNFSGLRALVTGAGGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGDWDATEKADLLVNNAALVIMQPFLEVTKEAFDRSFSVLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELG 168
68 -9.7403asu_A mol:protein length:248 Short-chain dehydrogenase/reductase SDR  ali model follow..  14  3.........................................................................................................................VLVTGATGFGECITRRFIQQGHKVIATGRRQERLQELKDELGDNLYIAQLDVRNRAACNIDILVN--NAGLALGMEPAHKASVEDWETMIDTNNKGLTRAVLPGMVERNHGHIINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLH 166
69 -9.7006ape_A mol:protein length:298 Bifunctional protein FolD  ali model follow..  12  45.....LVGKDPASITYVNMKIKACERVGMDFDLKTLNVTEAELLSLIKDYNTQNISGVLVQLPLPRHIDS--KMVLEAIDPSKDVDGFHPLNIGKLCTQKETPMGVMRLLKHYHIEIKGKDVAIIGASNIGKPLSMLMLNAGASVSVCHILTKDISFYTQ-------------------NADIVCVGV-----GKPDLIKASMLKKGAVVVDIGINHLNDGRIAQKVAGFITPVPKGVGSLLENTLIAFE..................... 285
70 -9.6602g1u_A mol:protein length:155 hypothetical protein tm1088a  ali model follow..  10  14.......................................................................................................................KYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGFTAAEFETLKECGMEKADMVFAFTNDDSTNFFISMNARYMFNVENVIARVYDPEKIKIFEEN----------GIKTICPAVLMIEKV.................... 139
71 -9.6401pr9_A mol:protein length:244 L-XYLULOSE REDUCTASE  ali model follow..  14  1................................................................................................................MELFLAGRRVLVTGAGGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERADLLVNNAAVALLQPFLEVTKEAFDRSFEVLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELG 168
72 -9.6202z1n_A mol:protein length:260 dehydrogenase  ali model follow..  13  1................................................................................................................MDLGIQGKLAVVTAGSGLGFASALELARNGARLLLFSRNREKLEAAASRIREPGDIDRLFEKARDLGGADILVYSTGGPRPGRFMELGVEDWDESYRLLARSAVWVGRRAAEQMVEKGWGRMVYIGSVTLLRPWQDLALSNIMRLPVIGVVRTLALELA 176
73 -9.6204a5o_A mol:protein length:286 BIFUNCTIONAL PROTEIN FOLD  ali model follow..  17  42.....LVGTDPASQVYVAHKRKDCEEVGFLSQAYDLETSQDDLLALIDRLNDPAIDGILVQLPLPAHLDA--SLLLERIHPDKDVDGFHPYNIGRLAQRMPTPKGIMTLLASTGADLYGMDAVVVGASNVGRPMALELLLGGCTVTVTHRFTRDLADHVS-------------------RADLVVVAA-----GKPGLVKGEWIKEGAIVIDVGINRQADGRLAAQRASWITPVPGGVGCLLENTLHAAE..................... 282
74 -9.5902c2x_A mol:protein length:281 METHYLENETETRAHYDROFOLATE DEHYDROGENASE-METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE  ali model follow..  15  39.....LVGDDPGSQAYVRGKHADCAKVGITSIRRDLDISTATLNETIDELNAPDCTGYIVQLPLPKHLDE--NAALERVDPAKDADGLHPTNLGRLVLGTPTPRGIVHLLRRYDISIAGAHVVVIGRGGRPLGLLLTRRSENATVTLCHTGTRDLPALTR-------------------QADIVVAAV-----GVAHLLTADMVRPGAAVIDVGVSRTDDGLVGDVLAGHVSPNPGGVGFLLTNVVELAE..................... 279
75 -9.5604oqz_A mol:protein length:289 Putative oxidoreductase YfjR  ali model follow..  16  2......................................................................................................................SQSVTVIGLGPMGQAMAAAYLDRGYEVTLWNRTASRADALVAR-----GAKLAATPEQALSANELVILSLIDYDAMYGVLEGAEEAVAGRVLVNL-----SSDTPEKARAAARRVAELGGTHL.............................. 114

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.