current user: public

If you have questions about the server, please let us know.

Query: 1o4s_A mol:protein length:389 Aspartate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380
# Score Template Links and tools%idFirst MGSDKIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNSYMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRGDDVKFCERLLEEKKVALVPGSAFLKPGFVRLSFATSIERLTEALDRIEDFLNSRLast
1 -118.0001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model  100  1MGSDKIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNSYMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRGDDVKFCERLLEEKKVALVPGSAFLKPGFVRLSFATSIERLTEALDRIEDFLNSR 383
2 -110.0001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  43  3......GLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRV--APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPDEVRAAERLL-EAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGR. 384
3 -108.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  37  1.....MKLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDQHLSIGAAPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAKSSLDFCSELLDQHQVATVPGAAFGADDCIRLSYATDLDTIKRGMERLEKFLHG. 386
4 -107.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  39  1......MLSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD--------FTVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETESMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGEDGREFAYKLLKEKFVALTPGIGFGGKNYIRISYANSYENIKEGLERIKEFLNK. 370
5 -107.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  38  1.....MALSDRLELVSASEIRKLFDIA----AGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDRHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTSKKFSELMLKEARVAVVPGSAFGGEGYVRISYATAYEKLEEAMDRMERVLKE. 385
6 -105.0005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  38  65SSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPTHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGLGKAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSADSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKALEP. 468
7 -102.0003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  30  3......LKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALEL---TDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAEANLDVYKANRKLMLERLPKAGTRIAPPDGAFYVYADVSDDSRAFAAEILEKAGVAVTPGLDFDGAGTLRFSYARATADIEEGLDRLEAFMQAR 382
8 -102.0005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  30  3......DRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA-WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDDSLAFCSKLLADTGVAIAPGIDFDGGSFVRISFAGPSGDIEEALRRIGSWLPSQ 388
9 -101.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  34  2....PMDLSKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTR-SNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGSHVSIAEY--LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVDSFKFLQDFAKEKAVAFIPGVAFGGEGYLRISYAASMETIKEAMKRLKEFMEQ. 390
10 -101.0003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  27  23VVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKKDFRISHWLINELGVVAIPPTEFYAENLLRFAVCKDDAYLENAVERLKLLKDY. 446
11 -101.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  33  1..AGSIRASKRALSV-EYAIRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLTK-DVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIEKNDKEFVLDVLHNAHVLFVHGSGFGGAGHFRAVFLPPIEILEEAMDRFEKFMKER 397
12 -99.4001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  28  1MTNNPLIPQSKLPQLGTTIFTQMSALA-----QQHQAINLSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ-PPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSADDVEFCQWLTQEHGVAAIPLSVFCPHKLIRLCFAKKESTLLAAAERLRQL.... 386
13 -98.7002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  28  4.DKIMDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERI-YENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAI-PQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSIES--DKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELPEDAEEFARWMLTDFNTMVAPLRGFYGKKEIRIACVLEKDLLSRAIDVLMEGLKM. 395
14 -97.9004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  28  1..MAKQLQARRLDGIDYNPWVEFVKLA-----SEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFNQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDYDRRFVKWMIKNKGLVAIPVSIFYFDHYIRFCFVKDEATLQAMDEKLRKWKVE. 421
15 -97.7002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  28  4.ESRPARRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEGSLEFAKKLLQDAKVSVSPGIGFGGDDHVRFALIENRDRLRQAVRGIKAMFRA. 397
16 -97.4002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  25  1.....MATVSRLRPYATTVFAEMSALA-----TRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHRHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPDSTEFCAALPEKVGVAAIPMSAFCDPALVRFTFCKRDDTLDEAIRRLSVLAER. 395
17 -97.3002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  25  9VPRGSHMISNKLANIPDSYFGKTMGRK--IEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPDSEQFEQFLVQEKSILVAPGKPFGGNRYVRISLALDDQKLDEAAIRLTELAYL. 396
18 -96.8003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  21  3..SIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVDAHTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGSYTHLRAEAAVAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPKAPAEFVKILRLQAGVVVTPGTEFSTADSVRLNFSQDHEAAVAAARRIVTLVER. 404
19 -96.4004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  27  20.AMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAGLEMLASMRLCANVPAQHAIQTALGGYQSTPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDHDDQKMVLDFLLQEKVLLVQGTAFNWPDHFRIVTLPRVDDIELSLSKFARFLSG. 421
20 -95.9001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  25  10..HNKFDLPKRYQGSTKSVWVEYIQLA-----AQYKPLNLGQGFPDYHAPKYALNALAAAANSPDNQYTRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETELNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSKDYRFTKWMTKSVGLQGIPPSAFYGEDFVRYCFFKKDENLQKAAEILRKWKGSS 429
21 -95.3001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  30  1.....MRLHPRTEAAKESIFPRMSGLA-----QRLGAVNLGQGFPSNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREF--APERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLAREALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG---WDAFRLVEEARVALIPASAFYPKDLFRFAFCKTEEELHLALERLGRVVNS. 370
22 -95.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  25  3............RVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTTYYCLKSCTLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPEDDLEFGLRLVER-GVALAPGRGFGGKGFVRIALVRPLEELLEAAKRIREALD.. 376
23 -94.8005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  28  1......ANAKRIEGLDSNVWVEFTKLA-----ADPSVVNLGQGFPDISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDINSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSYDYKFVKWMTKHKKLTAIPVSAFCFEKLVRFCFIKKDSTLDAAEEIFRAW.... 410
24 -93.6003ele_A mol:protein length:398 Amino Transferase  ali model follow..  26  1....GMVVNESMYQLVRSAIRELFEYGKAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPAD-TEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVP--FVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGATG--DINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKALEDDSNAFCEKAKEEDVLIVAADGFGCPGWVRISYCVDREMIKHSMPAFEKIYKK. 395
25 -92.0001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  25  1MSSWDV-SMSNHAGLVFNPIRTVSDNAK-PSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEACNGYFPTVGSPEAREAVATWWRNELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKFTSVADFETT-VPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDKTDVEFFEKLLEEENVQVLPGTIFHAPGFTRLTTTRPVEVYREAVERIKAFCQRH 413
26 -91.5004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  22  34.GSTKLVRNVNLEKLKNNPEINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHV--KSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSSGIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGKSWDVFNEILENTHIITVPGSGFGGEEYLRISGFGRRDHIVEASKRLQNFFNTR 442
27 -91.1003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  20  32AGTIDVQRNENFGKLRAGPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKATREGYSGYGAEQGQGALREAVASTFYGHAGRAA--DEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGPSWDVFAEILERCNIVTTPGSGYGGEGFVRASAFGSRENILEAVRRFKEAYGKR 440
28 -90.8002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  23  20.YKTKVSRNSNMSKLQAGPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGI--GDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNSSWDVFAEILEKTHVVTTPGSGFGGEGFVRVSAFGHRENILEACRRFKQLYK.. 426
29 -90.7006DK6 Entity 1(prereleased)  ali follow..  19  3.LINENFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGN-ILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKRRHSTKFNGASYIVQKGAEALYTDETKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPATSWQMFDKMLNEANVVITPGSGFGGEGYFRISAFNSRANVEEVCRRIAAL.... 410
30 -89.5003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  23  14FQSMWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGFLSSREEIASYYHCP-EAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRSQRILGPCTIVQGALKSILCRTPGETLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIEENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQH 418
31 -88.7003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  23  4.......RPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGYLSSREEVASYYHCP-EAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILQRTPQETLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIEENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVITVPEVMMLEACSRIQEFCEQH 401
32 -88.7003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  20  1.....MKRNPHFVSLTKNADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQSDRDLFDFFLREYHIAITPGIGFGGSGFVRFSSLGKREDILAACERLQMAPAL. 392
33 -88.5003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  18  11..IREKQNELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACNDDSVIEYGRKARIMKKMFLDNGFDGNEPLADGFYFTVGYKDSSKLIEKFVRYGMCAITLKTTGSRNEAMRICTSLLPESFPDLEKRLQMLNAE. 436
34 -87.0003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  20  2............MTFEPYPFERLRALLKEI-TPKKRGLDLGIGEPQFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEANEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDREFFRNIYANNLKLARKIFKNT----LIYPYSFYVYLPVQ-NGENFAKTLYQNEGIITLPALYLGGADYVRLALVYDTPLLEKPLEIIETYRENH 375
35 -86.8004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  23  33......RIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRFCQTKSKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNIFTSVADFDTN-VPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIARTLTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNKSDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCERH 436
36 -85.4003jtx_A mol:protein length:396 aminotransferase  ali model follow..  20  2.......MNTLLKQLKPYPFARLHEAMQGISAEGMEAVPLHIGEPKHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRDGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKQAAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPDDDLAFARNLWQKAAIQVLPGRFLAGEGYVRIALVADVATCVKAAEDIVSLYR.. 396
37 -85.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  22  9VPRGSHMSSLRPRREDPPVLEEWYRRH--LGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAG-----GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWE--VLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHADEARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFREEVERFCLELLERHRTLLVPGTAFGAPHGARLGFGGPQEDFRAGLDGLSRFLRER 396
38 -83.2003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  25  1........GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTG-----VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSEL----DVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIAVPMEDFCLQLLQEHGVLLVPGNRFERDGYVRLGFACEQETLIKGLEKLSQFLRR. 370
39 -82.8003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  18  48LQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPLDSPSFPEDAKARRILQACGGNSLGSYSASQGVNCIREDVAAYIRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDLYEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLSVRLCPPVSGQAAMDIVVNPPVSVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFAPDMFYCMKLLEETGICVVPGSGFGGTYHFRMTILPPVEKLKTVLQKVKDFHIN. 486
40 -81.7003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  19  69INNGIMAGYINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANN--YPVPDRCLVNTEKIINYFLQEKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSI----YSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVRLCADSRSYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYREQVDFLLKLAEKNGVVLVDGVGFGAPGELRVSQANLPTEYALIGKQVLELLKE. 524
41 -80.8003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  21  17......NLNPKVLKCEYAVRGEIVIHAQRLQEQHPDLLQREEIKTLFSAISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKFHSFKKIEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNIPKASDESYASYKAEILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQICAPDAFYALRLLESTGIVVVPGSGFGGTWHFRCTILPQEDKIPAVISRFTVFHEA. 483
42 -77.3002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  17  85...............GRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSL----FAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRKMADE 521
43 -77.2003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  17  77.......LAKIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSL----FAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRQMADE 521
44 -75.9002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  17  65..SYSYMTVGVGGLAKLDGRFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG---CNYPVPPRMLTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMAYIFSGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSL----FSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALD---HRYRSLLPDVRSLKFIDRLVADSRVVALNHTGLSTPQQVQNYYTLIDLQNSTGDMLFRVADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRRLADE 520
45 -75.8005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  16  6........................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQ-HGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGA-----DLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSDGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVEVAFAGRTGTEVWEELQRHHVFALPCRQFHGDHMVRIALSRSTEPLEKSVQVLRTVLETR 376
46 -75.1006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  13  8LVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA-EEGLQATYEKRFTEAFFQLHRQPTAL--VKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID--ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELAYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRDSAASVREVLTRNRECARKTLDGSILEYQEPVVKSVAWFRVDHLTATDVHRLLSADGVYVLPGRYFYGDAYVRMALAREPEMFADAMALTRQVLDR. 404
47 -74.3001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  22  3......MLSRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFISVMEVSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSGLVSSQTQHLLSAMLSDKKLTKNYIHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHAEMELWKKIVYEVHLNISPGSSCHEPGWFRVCFANLPERLDLAMQRLKAFVGE. 431
48 -72.6003if2_A mol:protein length:444 Aminotransferase  ali model follow..  18  2.....MKFSKFGQKFQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDADNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAH--LNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKDSTLDLYERLKAK-GTLIVPSEYFFAHECIRMSIAADEQTLIDGIKVIGEVVRE. 439
49 -71.2003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  18  2.....MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFSEARPL--WNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNETVIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDITTELLYQRLKARGVLMVPGHYFFTHQCMRMNYVPEPDKIEAGVKILAEEIER. 412
50 -71.0001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  22  1......ILSKLATNEEHGENSPYFDGWKAYLKNPNGVIQMGLAENQLNPKGSICSEGIKSFK-AIANFQDYHGLPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTQFVSIAEILDEKDLVHIVYSLSKDMGLPGFRVGIIYSFDDVVNCARKMSSFGLVSTQTQYFLAAMLSVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPSEMSLWRVIINDVKLNVSPGSSFEEPGWFRVCFANMDDGVDIALARIRRFVGVE 427
51 -66.3002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  15  3MNPLAQSLNEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMATNKDGKSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNP---NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTALTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHDDPEALRKHLIDKYSIGVIALNATD----IRIAFSCEKDDIPHVFDSIAKAIDD. 428
52 -63.7003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  18  2..............VKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIDLMSYFSDMTNPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHY-------TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKEYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYFGLGTKEETDLVSELRRHKVMSRAGERCGDKKHVRVSMLSREDVFNVFLERLANMKLIK 387
53 -61.6004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  20  2.NAMPMTIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDDKGKSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGIKEIIEEFEASLAHSARCNWSNGTHAAQNILEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPT--DKAFDIVKDLEKENIFTIPSAKGI-----RVAICVGEEKIPKLVQRLAFYTNKK 413
54 -60.4001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  14  30........GIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVRMSYFFNPVSNFIFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT-------PIKYKADEDILLFTMSKFTGHSGSRFGWALIKESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVTFGFKKLRERWVNITALLDQSDFRRMRPPSPSYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFESSRYVRLSLIKTQDDFDQLMYYLKDMVKAK 425
55 -60.3003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  17  1.......MFENITAAPADPILGLADLFRADERP--GKINLGQGVYKDETGKSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDATDMRQRIQRMRQLFVNTLQEKGANDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASG--------RVNVAMTPDNMAPLCEAIVAVL... 396
56 -60.3003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  17  1.......MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGIIPQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQNYSSPPNFGAQVVAAVLNDEASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNQRGLSAAQVDRLREEFGVYLIASG--------RMCVAGNTANVQRVAKAFAAVM... 397
57 -60.2004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  16  1...MAVGTFENITAAPADPILGLADLFRADERP--GKINLGIGVKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDATDMRQRIQRMRQLFVNTLQEKGARDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL... 400
58 -59.9003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  17  3.AMTSVAAKHAKGKKLKDVIFVTAGQAQAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEFNKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPANCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD-SANAICEELKKEHIYVIALANGIAACGIPKCQMTGLAEKIYNAMKSLGKL.... 418
59 -59.7004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  16  1.....MAMFEHIDAYPGDPILTLNENFQKDPRD--QKVNLSIGIYDAEGRIPVMGAVREARDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLASNPQTYGAKVVAAVLGTPAQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKQRGLTESQVDALREVHGVYILRSG--------RMCVAGNDSNVGIVADAIGKVLKS. 400
60 -59.4001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  15  1.......MLGNLKPQAPDKILALMGEFRADPRQGK--IDLGVGVYDATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLTVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMASFPPFHGAKIVSTVLTTPEDWMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEHRGATPEQVKRIKEEFGIYMVGDS--------RINIAGNDNTIPILARAIIEVG... 393
61 -59.1005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  15  2......SWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQMYSNPPLNGARIAAAILNTPDQWLQEVKGMADRIIGMRTQLVNLKKEGSTHNWQHITDQIGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK......... 401
62 -58.7001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  16  1.......MFENITATTADPILGLADLFRADERPGK--IDLGIGYKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEAEGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGLTKEQVLRLREEFGVYAVASG--------RVNVAMTPDNMAPLCEAIVAVL... 396
63 -58.7002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  16  1.......MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYDETGKTPVLTSVKKAENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDATDMRQRIQRMRQLFVNTLQEKGANDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL... 396
64 -58.0004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  19  11QGPGSMSLFSAVELAPRDPILGLNEAFNA--DTRPTKVNLGVGVYTNEDGKIPLLRAVRVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKSNPPTHGGAIVAAVLASPESWVQELGEMRDRIRAMRNGLVRLKAAGIERDFSFINAQRGLTSAQVDRLREEFGIYAVSTG--------RICVALNTRNLDVVANAIAAVLK.. 414
65 -57.9004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  13  3MGTLEAQTQGPGSMGKPDPILGLGQDFRMDPAK--RKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQDAFVPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLANNPPLYGAWVVSSILKDPQLWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGLTREQVELLRSEYHIYMTLNGRAAVSG-------LNSTNVEYVSQAIHNVTK.. 403
66 -57.8004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1...........MAMGKPDPILGLGQDFRM--DPAKRKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQDAFVPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLASNPPLYGAWVVSSILKDPQLWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGLTREQVELLRSEYHIYMTLNG--------RAAVSLNSTNVEYVSQAIHNVTK.. 390
67 -57.4002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  15  1.......MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYNDETGKTPVLTSVKKANETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGLTKEQVLRLREEFGVYAVASGRLNVAG-------MTPDNLAPLCEAIVAVL... 396
68 -57.1003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  14  2......SWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDNGKPYKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVKRVESQLKILIRPLYSNPPLNGARIAATILTSPDQWLQEVKGMADRIISMRTQLVNLKKEGSSHNWQHITDQIGLKPEQVERLTKEFSVYMTKDGRISGVTSGNVGYLA--HAIHQVTK......... 401
69 -56.1003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  15  1..............MQPVLVFKLTADFREDPDPGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR-GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMESNPPAQGARIVASTLSNPEEWTGNVKTMADRILTMRSELRRLEALKTPGTWNHITDQIGLNPKQVEYLVNEKHIYLLPSGRINVSGTKNLDYVATVTKIAENLYFQSDYKDD. 413
70 -56.1001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  1.......MFENITAAPADPILGLADLFRADERP--GKINLGIGLYYDETGKIPVLTSVKKAEQTTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.......... 396
71 -54.0001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  1.......MFENITAAPADPILGLADLFRADERP--GKINLGIGVYDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQNYSNPPAHGASVVATILSNDAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGLTKEQVLRLREEFGVYAVASG--------LVNVAGTPDNMAPLCEAIVAVL... 396
72 -53.4004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  15  1...MAVGTFENITAAPADPILGLADLFRADERPGK--VDLGIGYKDETGKTPVMTSVKKAENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSSPPAHGASVVATILSNDAIWEQELTDMRQRIQRLRQLFVTLQEKGANRDFSFIIKQNGLTKEQVLRLREEFGVYAVASG--------RVNVAMTPDNMAPLCEAIVAVL... 400
73 -52.3001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  16  1.......MFENITTAPADPILGLADLLRADERP--GKIDLGMGTGKTPVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQNYSSPPAHGASVVATILGNDAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGLTKEQVLRLREEFGVYAVASG--------RLNVAMTPDNLAPLCEAIVAVL... 396
74 -51.9003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  22  15..........................TMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQREAFGYQPDGS--LLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT----GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVDTAASVCITITAPSKAWNIAGLKCAQIIFSPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTNQEVAYLKNNHDFLLHEIPK-GAKITPMQATYLMWIDFRD-EGSPSEFFIEKAKVAMNDGAWFGGTGFCRLNFATSREVLEEAIDRMAKAVSHH 376
75 -50.3002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  25  4....TKYLAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPEL-AVLGEIAKEVLEKEPKMYTPANGIPELREELAAFLKKYDHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG---MRVDLLEEKIKELKAKLIYTIPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDNEGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKRGLEGALLGYKEKRDIMLKALEN-NAEFTKPIAGMFVMFFLPEDGISFANELMEREGVVVVPGKPFSGKNAIRLNFSPSKEEIPIGIKKLAKLYKEK 404

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.