current user: public

If you have questions about the server, please let us know.

Query: 1oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSFLast
1 -120.0001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model  100  1MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF 439
2 -114.0004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  49  1.....................MARKTNIEAYRDGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREKVPWIKEIRGRGLLNAVEVDSD-AIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV 420
3 -113.0004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  47  3........TKSDGSASAAAEGGARKTNIEAYRDGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREKVPWIKEIRGRGLLNAVEVDSD-AIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV 435
4 -110.0005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  61  1...............................MAMSETKNSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRAFYNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLARKWSYEVKGIAENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYGPFTPGFIRIPYNDIAALEEVLSKGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKLIACHHEDVQPDILILGKALSGGMYPVSAVLANNNIMDVIKPGQHGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLKTDLITKVRGKGLLNAILINDTPDSSAWNLCLALKENGLLAKPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF 413
5 -110.0003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  50  1........................................KDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTNKEMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYGDLEALKAAI-TPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEIDNPMITEVRGKGLFIGIELNEP----ARPYCEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVLS.. 392
6 -109.0003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  54  1..............................MDFVKELKSSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRAFFSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWGYEVKKIPENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFGPFVPNFLKVPYDDLEALEKELQDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGEHGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQDSKVVREVRGKGLLCAIEFKNDLV-NVWDICLKFKENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFF 410
7 -108.0001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  53  1.................MGSSSSGLVPRGSMEFVKDLKTPEDYINNELKYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFGPFAPQFSKVPYDDLEALEEELKDPNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKREDSKIVRDVRGKGLLCAIEFKNELV-NVLDICLKLKENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTVKFF 423
8 -104.0004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  33  2..........................RGSGMASHMATEQTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHS--PFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVM-DDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGF-PVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKV 412
9 -103.0004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  32  2......................................SQPITRENFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALI-DDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTIRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
10 -102.0001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  33  1...............................METRTLEDWRALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAILELNRVFPVNSGTEANEAALKFARAHT--------GRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAV-DEETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGV-PLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIREVRGMGLMVGLELKEK---AAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA.. 395
11 -101.0002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  34  1..........................................MGSDKIMYLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKKS---EKKYRILSAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKM-SEDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGGV-PIGAVIVN-ERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMEYDVVADVRGMGLMIGIQFREEVS--NREVATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVLQGI 391
12 -100.0003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  31  2.........................................KMDYKEQSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSNLYYNENIAAAAKNLAKASALERVFFTNSGTESIEGAMKTARKYAFNKG---VKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFKPLISGVKFAKYNDISSVEKLV-NEKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCGL-SVGAFVINQKVANSLEAGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELEFDFCKKRKGLGFMQGLSLDKS--VKVAKVIQKCQENALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF 395
13 -95.9002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  36  1................................................TYLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSNLYENPWQEELAHKLVKHFWTEKVFFANSGTESVEAAIKLARKYWRDKG---KNKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLL-DEETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGGV-PIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELG---KGKVKGRGLMLGLELERE----CKDYVLKALEKGLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL... 375
14 -95.4004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  30  14..................SAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLAKAYQS-----PRGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNEDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLARDLVQEARGKGMLMAIEFVDNE--IGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAM 452
15 -94.9005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  29  2........SHMSASALACSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGFLEYAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLAKAYQS-----PRGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNEDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLARDLVQEARGKGMLMAIEFVDNE--IGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAM 450
16 -91.5004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  27  352VTNLKRYYHHDIYAGESADAALPASRLAFIDAVIAQTPAREDTLDRYHQYINPKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPIQYISIPEQTAKLAEVLCRLANMGRVFFSNSGTEAVEAAMKIAKAS--------TGKPGIAYLRNSYHGKTLGALSITGRDKHRRYFTPLLDAMVEVPFGDLAALREALNREDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCRADLWQKARFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIRYPFVSEVRGRGLMLGIQFDQA---FTGAVNASAREFATRLPGDWHTTWKFLPDPVQ--AHLRAAMDRMEQALGEM 794
17 -90.2002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  26  2........................AAVVKSVALAGRPTTPDRVHEVLGRSMLVDGLDIVLDLTRSGGSYLVDITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKVYSVAMARFVETFARVLALPHLFFVEGGALAVENALKAAFDWKSRHNQAPALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPFDWPRIDAPYRQARAAFETR-PHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFVLDPRGRGLMCAFSLPTTA--DRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV 448
18 -89.8004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  28  1.............MTTTANELSYRIEQKRNINGAFPGPKSQALAERRSAVVAAGVASVPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCFMVTYEGYVAVTEQLNRLTPAKRTVLFNSGAEAVENAVKVARLA--------TGRDAVVAFDHAYHGRTNLTMALTAKAPYKTNFGPFAPEVYRMPMSYITMIEKQIGGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGGL-PLSAITGRADLLDAVHPGGLGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAGSVVGDIRGRGAMLAIELVQPGSKETKAVAAACLKEGVIILTCGGNVIRLLPPLVISDELLIDGLEVLAAAIKAH 455
19 -88.5001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  29  2.....................................NSNKELMQRRSQAIPRGVGQHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCQVLAYEPYLELCEIMNQKVPGDKTLLVTTGSEAVENAVKIARAA--------TKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYREDDAIASIHRIFKPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGF-PLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIKHPEIGDVRGLGAMIAIELFEDGDHNTAEIVARARDKGLILLSCGYNVLRILVPLTIEDAQIRQGLEIISQCFDEA 424
20 -88.3002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  31  2......................................LSRKIIEESDIYLATSTRDFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAANDFYNIPQLELAKKLVTYSPGNKVFFSNSGTEAIEASIKVVKNTG---------RKYIIAFLGGFHGRTFGSISLTASKAQRSIVGPFMPGVIHVPYPNIEFIEDYIPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGIMPIGATIFRKDLD--FKPGMHSNTFGGNALACAIGSKVIDIV--KDLLPHVNEIGKIFAEELQGL----ADDVRGIGLAWGLEYNEKKV--RDRIIGESFKRGLLLLPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVV 418
21 -87.1003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  30  1................GPGSMVSHPEQSRHLATAIPGPRSQALIDRKGTAVARGVGTMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDFTHTCFMVTYEGYVAVCEQLNRLTPDKRSALFNSGSEAVENAVKIARSH--------THKPAVVAFDHAYHGRTNLTMALTAKVPYKDGFGPFAPEIYRAPLSYPTVIDKQIGADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGGL-PLSAVTGRAEIMDSPHVSGLGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLEDDRIGDVRGRGAMIAMELVKAGTTETKALCAGAHAAGVIVLSCGGNVVRFLPPLSIGDDLLNEGLDVLEEVLRG. 450
22 -86.6003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  30  14......................RTLTQERRLVTAIPGPISQELQARKQSAVAAGVGVLPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTYEGYVKVAEHLNRLTPGDRTALFNSGAEAVENAVKIARAY--------TRRQAVVVFDHAYHGRTNLTMAMTAKNQYKHGFGPFANEVYRVPTSYLDLINKQVGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHENVVPDLIVTAKGIAGGL-PLSAVTGRAEIMDGPQSGGLGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAAPRIGEVRGRGAMIAVELVKPGTTETKRVAAAAHAQGLVVLTCGGNVLRFLPPLSMPDHLLDEGLDILAAVFAEV 452
23 -85.7004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  30  11.......................RLAQKRTIVTPLPGPRSGALAERRRAAVSAGGSTAPVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHFTHTCFMVTYEQYVQVAELLNALTPGDRTALFNSGAEAVENAIKVARLA--------TGRPAVVAFDNAYHGRTNLTMALTAKSPYKSQFGPFAPEVYRMPASYISRIETQIGAQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFARTGAWFASEHEGIVPDIVTMAKGIAGGM-PLSAVTGRAELMDAVYAGGLGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEDIIGEVRGRGAMLAIEIVKPGTLETKSIAAEALSQGVLILTCGGNVIRLLPPLVIGDDLLDEGITALSDIIRAK 449
24 -85.2003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  28  18......................ASLDQSRLLVTEIPGPASLELNKRRAAAVSGGVGVLPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQFTHTCFMVTYEQYVAVAEQLNRITPEKRTVLFNSGAEAVENSIKVARAH--------TRKQAVVAFDYAYHGRTNLTMALTAKSPYKSGFGPFAPEIYRAPVSYINLIDKQIGAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGF-PLSAVTGRAEIMDAPHTSGLGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQADRLGDVRGRGAMIAMELVKSGTAETQKLAAAAHAAGVIVLTCGGNVIRLLPPLTISDELLSEGLDILCQILAD. 461
25 -85.1005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  23  1..............................MSLTVQKINWEQVKEWDRKYLMRTFSTQPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDRYGFVWDTYATDYKAKAAKIIIEDILGDKVRFVSTGSEAVETALNIARLY--------TNRPLVVTREHDYHGWTGGAATVTRLRSYRSGLSSYNSAVLMAPSKYTRRMIENYGPEQVAAVITEVSQGAGSA-MPPYEYIPQIRKMTKELGVLWINDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVLVSKEIAAFMDKHRSVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELLKHKSIGNFDGYGLLWIVDIVNAKTKTTQIIMKKALEKGVLIGGVMPNTMRIGASLNVSRGDIDKAMDALDYALDYL 468
26 -85.0005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  24  1..............................MGLTVQKINWEQVKEWDRKYLMRTFSTQPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDRYGFVWDTYATDYKAKAAKIIIEDILGDKVRFVSTGSEAVETALNIARLY--------TNRPLVVTREHDYHGWTGGAATVTRLRSFRSGLVGENSAVLMAPSKYTRRMIENYGPEQVAAVITEVSQGVGST-MPPYEYVPQIRKMTKELGVLWISDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVVVSKEIAAFMDKHESVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLKHKSIGNFDGYGLLWIVDIVNAKTKTTQIIMEKALEKGVLIGGAMPNTMRIGASLNVSRGDIDKAMDALDYALDYL 468
27 -84.9005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  24  1.................MGSSSSGLVPRGSHMTKQTSAQTQHWQALSREHHLAPFTDYARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLELPYYNLFTAHPPALELAKAIADIAGMNHVFFTGSGSESNDTVLRMVRHYWSIKG--KPQKKVVIGRWNGYHGSTVAGVSLGGMKALHSQGDLPIPGIVHIAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVIVRDEIVDTLNEGGHGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQEDHPLVGEARGVGMVGALELVKNKKTRGMLCREHCFRNGLIMRAVG-DTMIISPPLVITKPEIDELITLARKCLDQT 462
28 -84.7004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  25  1.................MGSSSSGLVPRGSHMNQQVNVAPSAAADLNLKAHWMPFSANPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGTLDYSPGFYGHPLSFQLAEKIAQMTTLDHVFFTGSGSECADTSIKMARAYWRIKG--QAQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGPLMDVDHLPHANELLKLIELHDASNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFGRMGKATGAEYFGVTPDIMNVAKQVTNGAVPMGAVIASSEIYDTFMNQNHGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGLKGKNVIDIRNCGLAGAIQIAARDGDAPFEASMKLWKEGFYVRFGG-DTLQFGPTFNAKPEDLDRLFDAVGEALNGV 461
29 -84.5004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  23  2.......................GSSSSGLVPRGSHMNKPQSWEARAETYSLYGWTDMTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERFPGYHAAKMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGATAVSASMTGFP-YNSVFGLPLPGFVHLTARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIERPNIGEYRGIGFMWALEAVKDKASKSERIANTCTDLGLICFPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKV 462
30 -84.4001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  21  1.............SQAAAKVDVEFDYDGPLMKTEVPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALENFVEKLRESLLSVAGMSQLITMACGSCSNENAFKTIFMWYRSKERGQCPDYSILSFMGAFHGRTMGCLATTHSKAIHKDIPSFDWPIAPFPRLKLEEVEDLIVKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKMMTGG-FFHKEEFRPN-----APYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQAQFISRVRGRGTFCSFDTPDES--IRNKLISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDILADF 471
31 -84.3003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  25  9...................QGTENLYFQSHMAAATGGLTPEQIIAVDGAHLWHPYSSIPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGLTHEPAARLAKLLVDITGLDTVFFSDSGSVSVEVAAKMALQYWRGRG--LPGKRRLMTWRGGYHGDTFLAMSICDPHGMHSLWTDVLAAQVFAPQVPSAAFEAQLAAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGARGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARAPAVTDVRVCGAIGVIECDRPVD--LAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLV 452
32 -84.3003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  26  3..................SSSSGLVPRGSHMAAATGGLTPEQIIAVDGAHLWHPYSSIPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGLTHEPAARLAKLLVDITGLDTVFFSDSGSVSVEVAAKMALQYWRGRG--LPGKRRLMTWRGGYHGDTFLAMSICDPHGMHSLWTDVLAAQVFAPQVPSAAFEAQLAAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGAHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARAPAVTDVRVCGAIGVIECDRPVD--LAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLV 447
33 -84.2004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  23  2.......................GSSSSGLVPRGSHMNKPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFRMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFVHLTARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIERPNIGEYRGIGFMWALEAVKDKASKSERIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKV 462
34 -84.2003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  22  2.......................ASMTGGQQMGRGSMNKPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFRMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFVHLTARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIERPNIGEYRGIGFMWALEAVKDKASKSERIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKV 462
35 -84.1003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  24  3.....................................LKNDQLDQWDRDNFFHPSTHLNRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQARELAYYHSYHGTEASITLAKMILDRAPMSKVYFGLGGSDANETNVKLIWYYNNILG--RPEKKKIISRWRGYHGSGLVTGSLTGLELFHKKFDLPVEQVIHTEVAELEALIEREGADTIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTMFGSDHYGLEPDIITIAKGLTSAYAPLSGSIVSDKVWKVLEQGTHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEAQHANVGDVRGEGLLCAVEFVKDRDSRGPQISAKLLEQDKIIARAMGDILGFAPPFCLTRAEADQVVEGTLRAVKAV 456
36 -84.0004grx_A mol:protein length:465 Aminotransferase  ali model follow..  24  2.........................ASWSHPQFEKGANQPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRFPGYHAFRMSDQTVMLSEKLVEVSPNGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFIHLTARELEDTITREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFGRTGNTWGCLTYDFMPDAIISSKNLTAGFFPMGAVILGPDLAKRVEAAVHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKRIDRPNIGEYRGIGFMWALEAVKDKPTKSERIANTCTDLGLICRPLG-QSIVLCPPFILTEAQMDEMFEKLEKALDKV 460
37 -84.0004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  27  2......................SGGIEGRHMELMGKLDKASKLIDEENKYYARSINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAFHHVPGMELSEKLAKIAPGNMVSFGNSGSDANDAIIKFARAY--------TGRQYIVSYMGSYHGSTYGSQTLSGSSNMTRKIGPMLPSVVHVPYPDSKPFESFLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMRHPMIGDVRMWGLNGGIELVKDPKTKATKVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAV 446
38 -83.9006erk_A mol:protein length:451 Aminotransferase  ali model follow..  26  2........................GSDKIENLYFQGHMTTVSTNDFDQQHLWHPYASLNIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGKMAHVMFGLTHQPAIDLGKKLLSIVGLDAIFYADSGSIAVEVALKMALQYQIAAK--RPSKCQFASTHSGYYGDTWHAMSVCDPNGMHSLYGKQLPMQHFVAAPEALTEFFVKNSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFGRSGKLFACEHAAISPDIMTIGKALTGGYMTFAATLSTREIADTISQSDHGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPAVSEGVKEVRCLGAVAVIELNEAVD--MPIFQTLLINNGIWVRPFG-KLVYIMPPYVITDDELTTLCQALLKVVSSY 440
39 -83.8003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  26  1................................NMPEHAGASLASQLKLDAHWMPYTANPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLSTLDYSPGFYGHPLSFQLAEKITDLTNLNHVFFTDSGSECALTAVKMVRAYWRLKG--QATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQPMQDVDHLPADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASTEIYQTFMNQPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGIKGKNVIDIRNFGLAGAIQIAPRDGDAPFEAGMALWKAGFYVRFGG-DTLQFGPTFNSKPQDLDRLFDAVGEVLNKL 447
40 -83.8003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  25  1...............................SNAMKTKQTDELLAKDEQYVWHGMRPFTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQTLSYFPMSQSHEPAIKLAEKLNEWLGEYVIFFSNSGSEANETAFKIARQYYAQKG--EPHRYKFMSRYRGYHGNTMATMAATGQAQRRYQYEPFASGFLHVTVKEVDRVMTWELSETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKAFGFMNYDVKPDIITMAKGITSAYLPLSATAVKREIYEAFKGKGHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEEHPLVGDIRGKGLLVGIELVNDKETKIASVVNACKEKGLIIGRNGNNILTLAPPLVISSEEIAFVIGTLKTAMERI 452
41 -83.7005ghf_A mol:protein length:456 Aminotransferase class-III  ali model follow..  26  1...................................MTAQPNSLEARDIRYHLHSYTDAPLVIERGDGIYVEDVSGKRYIEAMSGLWSVGVGFSEPRLAEAAARQMKKLPFYHTFRSHGPVIDLAEKLVSMAPMSKAYFTNSGSEANDTVVKLIWYRSNALG--EPERKKIISRKRGYHGVTIASASLTGLPNNHRSFDLPIDRILHTGADELEQLIIAEGPHTIAAFIGEPVMGAGGVVVPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNLFGSQTFDMKPDILVMSKQLSSSYLPISAFLINERVYAPIAEESTGFTASGHPVAAAVALENLAIIEERDLVANARDRGTYMQKRLRELQDPLVGEVRGVGLIAGVELVTDKQAKGAKANAVLQERGVISRAMG-DTLAFCPPLIINDQQVDTMVSALEATLNDV 450
42 -83.5003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  23  2.............................SLATITNHMPTAELQALDAAHHLHPFSANTRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRELPYYNTFTTHVPAIALAQKLAELAPLNHVFFAGGGSEANDTNIRMVRTYWQNKG--QPEKTVIISRKNAYHGSTVASSALGGMAGMHAQS-GLIPDVHHINARELEEAILELGENRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYAPIGGSIVCDEVAHVIGKDEHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEADHPLVGEAKIVGMMASIALTPNKASRGYICRERCFANNLIMRHVG-DRMIISPPLVITPAEIDEMFVRIRKSLDEA 452
43 -83.4003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  21  2..............................SLRNDATNAAGAVGAAMRDHILLPAQEMQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYASPWMATSPAARLAEKIATLTDLNRIFFTTGGSTAVDSALRFSEFYNNVLG--RPQKKRIIVRYDGYHGSTALTAACTGRTGNWPNFDIAQDRISFLSVQEFEDRIESLGPDTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKFGVVPDIITFAKGVTSGYVPLGGLAISEAVLARISGENNGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASLRDPGVAETRSVGLVGCVQCLLDPTRATLKIDERCFELGLIVRPLG-DLCVISPPLIISRAQIDEMVAIMRQAITEV 454
44 -83.1003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  25  1..................................GMLNQSNELNAWDRDHFFHPSTHMTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHAYHGTEASITLAKMIIDRAPMSRVYFGLSGSDANETNIKLIWYYNNVLG--RPEKKKIISRWRGYHGSGVMTGSLTGLDLFHNAFDLPRAPVLHTEADKLEEMILAEGPETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAKGLTSAYAPLSGVIVADRVWQVLVQGSHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAGHKNVGEVRGDGMLAAVEFVADKDDRGPQVATALAASGVIGRAMPGDILGFAPPLCLTREQADIVVSKTADAVKSV 456
45 -83.0004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  25  1...............................MNQPLNVAPPVSSELNLRAHWMPFSANPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFYGHPLSFQLAEKIAGLLELNHVFFTGSGSECADTSIKMARAYWRLKG--QPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLMDVDHLPHANELLKLIELHDASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQAHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQGKNVIDIRNCGLAGAIQIAPRDGDPPFEAGMKLWQQGFYVRFGG-DTLQFGPTFNARPEELDRLFDAVGEALNGI 447
46 -83.0003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  27  2................................................SNVFYRSSKPYPVAVRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHGSFSSDVLEEYAGRLARFVGTFRFWAVSGGSEATESAVKLARQYHVERG--EPGRFKVITRVPSYHGASLGSLAASGMGARRELYTPLMRPEAWPKLEGLRALLEREGPETVAAFMAEPVVGADAALAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIAVLGKGLAAGYAPLAGLLAAPQVYETVMGGSHGFTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALRFPQMMQVRGTGLLLGVVLGDLATGQASRIGAAALKRGLITYPGSGDHLLLGPPLSITAAEVDGLLALLAGALEDV 428
47 -82.7005dds_A mol:protein length:523 CrmG  ali model follow..  22  1..................................MTHPSGEPVYADAVLNGWLTSMGLGVEYVRAEGNTVYDDEGREVLDHACGFGSLIFGHNHPEIIAHAKAALDAGTVVHAQLSQPRANQISRILNDIMDRYNAIFANSGAEANEICMKHAELERQERDERRAERPLFLTLDGSFHGKLVGSIQLTQNEPWRTPFTALSSPARFLPADEPELIGKIVEDPVVAAIFVEPVRGGSGMKTVTPELAEELHRLRDTLGCPLVVDEVQTGIGRTGAFFGSALLGIRGDYYTLAKAIGGGIVKNSVALIRQDRFLPAMEVIHSSTFAKDGLSASIALKVLEMVEADRVYQRVRERGQRLEAMLESVRADVVSAVWGTGLMLALELRDQSNATYVLAGFLLREHHIRVLPAGSGFLRFSPSLYITDEEIDRTETALRSLFTAL 512
48 -82.6001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  25  2.......................................TTDDLAFDQRHILHPYTSMVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWQAKG---EARQRFLTFRNGYHGDTFGAMSVCDPDNMHSLWKGYLPENLFAPAPQMVGFARLMARHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDEMVADVRVLGAIGVVETTHPVN--MAALQKFFVEQGVWIAPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDE 424
49 -82.5005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  28  2.....................................GSSYEKYKNAEKKFWHPMGSSTLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDELAYYQTFIAHPRVFDLAERLTGMFRMARVLFSSGGSDAVETALKMARQYWIASG--EPGRTRFLSLRNGYHGVHMGGTSVGGNGVYHYNHGQLLAGCHLLDIRQLEEQIALLGAQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFGRSGCMLGSRGWGVAPDILCLAKGITAGYIPLGATLFNQRIADAIENGQHGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLRYAVVGEVRGKGLMIALDLVSDKRTRPSRIADEARRAGVLVRPIG-NKIILSPPLTLTRDEAGLMVSALEAAFARC 451
50 -82.4001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  26  2.......................................TTDDLAFDERHIWHPYTSMVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMGEITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWDAKG---EARDRFLTFRNGYHGDTFGAMSVCDPDNMHSLWKGYLPENLFAPARDMVGFARLMARHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISDGEHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDEMVADVRVLGAIGVVETTHPVN--MAALQKFFVEQGVWIRPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDE 424
51 -82.2005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  26  2.....................................GMTTDDLAFDRRHIWHPYTSMVFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDAMSHVMFGITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWQAKG---ESRQRFLTFRNGYHGDTFGAMSVCDPHNMHSLWKGYLAENLFAPARDMVAFARLMARHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRLFACEHAGIAPDILCLGKALTGGTMTLSATLTSRQVAETISNGEHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPAADPQVADVRVLGAIGVVETTRPVN--IAALQQFFVRQGVWVRPFG-KLIYLMPPYIIQPEQLRRLTQAVNEAVREE 426
52 -82.2005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  2.......................GSSSSGLVPRGSHMTSLEQLLEMDRAHFMHPSTHAGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQLAYYHTYHSNDPVIELSSRIIEDWGMKKVFYGMSGSDANETQIKLVWYYNNVLG--RPNKKKIIARERSYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVVEELEKLIAREGADTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKTGSEHYGIKPDLITVAKGLTSAYAPLSAVIVSEKVWDVIEKGSHGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAAHPLVGEVRGVGMLAALEFMADKGARSQKVAAAALEDGLIVRALPGDILGFAPPLVTTRAEVDEIVAIAKEAFDEV 468
53 -82.0005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  27  3...........SSSSGENLYFQGHMASGSEFELMGKLDKASKLIDEENKYYARSINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAFHHVPGMELSEKLAKIAPGNMVSFGNSGSDANDAIIKFARAY--------TGRQYIVSYMGSYHGSTYGSQTLSGSSNMTRKIGPMLPSVVHVPYPDSKPFESFLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMRHPMIGDVRMWGLNGGIELVKDPKTKATKVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAV 458
54 -81.9005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  2.......................GSSSSGLVPRGSHMTDFDQLFEQDRAHFMHPSTHAGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKELAYYHTYHSTEAIIELSSRIIRDWGMKKVYYGLSGSDANETQIKLVRYYNNVLG--RPQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFDLPVEGIKHTVADELEKLILAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFGRLGSKMGSQRYGMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIEKASHGWTYSGHPICAAAALANLDILERENLTANAADVGAYLNQRLRETGHPLVGEVRGDGMLAALEFMADREARGPKVSAACLEDGMIARAMPGDILGFAPPLVLTRAEADEIVGIAKAAVDEV 468
55 -81.6001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  27  1..................................MSLNDDATFWRNARQHLVRYGGTFPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSGMLSRPVVDLATRLANITGLDRALLLSTGAESNEAAIRMAKLV--------TGKYEIVGFAQSWHGMTGAAASATYS-AGRKGVGPAAVGSFAIPAPFAFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGL-PLAAIVTSAAIEERAHELGFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLRFDCIGDVRGRGLLLGVEIVKDRRTKGAKITRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA 432
56 -81.6005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  27  2.......................GSSSSGLVPRGSHMTDLDQLFEMDRAHFMHPSTHAGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKELAYYHTYHSTEAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKLVWYYNNVLG--RPQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFDLPIERIKHTVADELEKLILAEGPDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFGRLGSKMGSQHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLRETGHPLVGEVRGVGMLAALEFMADKDARGPKVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVGIAKQAVDEV 468
57 -81.5005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  2.......................GSSSSGLVPRGSHMTSLDQLFEEDRAHFMHPSTHAGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYHSTDAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKIVWYYNNVLG--RPNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVVEELEKLIAREGADTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFGRLGSKMGAQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAAHPLVGEVRGVGMLAALEFMADKDARGPKVSAAALEDGVIARAMPGDILGFAPPLVTTRAEVDEIVGIVKQAVDEV 468
58 -81.3005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  27  2.......................GSSSSGLVPRGSHMTDTDDLLEMDRAHFFHPSTHLGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKELAYYHTYHSNEPIIELSERIIREWGMSKVYYGMSGSDANETQIKLVWYYNNVLG--RPQKKKIISRQRGYHGSGIMTGSLTGLPAFHNHFDLPLEPIRHTTADELEKMILAEGPDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFGRTGSMFGSHHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWKVLEQGSHGWTYSGHPICAAAALANLDIIERENLTGNAADTGAYFQQRMRETDHPLVGEVRGVGLMAALEFVADKDKRGPRVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVDIAKQAVDAV 468
59 -81.2005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  2.......................GSSSSGLVPRGSHMQSLDQLFEMDRAHFMHPSTHAGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYHSTDAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKLVWYYNNVLG--RPNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVVEELEKLIAREGADTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKMGSQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAAHPLVGEVRGVGMLAALEFMADKDARGPKVSAAALEDGMIARAMPGDILGFAPPLVTTRAEVDEIVGIAKQAVDEV 468
60 -81.2005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  25  2.......................GSSSSGLVPRGSHMTDYAKLFEQDRAHFMHPSTHAGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQLAYYHTYHASEAIIELSARIIRDWGMKKVYYGLSGSDANETQVKLVRYYNNVLG--RPQKKKIISRQRGYHGSGIVTGSLTGLASFHQHFDLPVEGVKHTLAQELENLILAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFGRLGDKMGSQRHAMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIDSASHGWTYSGHPICAAAALANLDILERENITANAADVGGYLNQQLRQAGHPLVGEVRGDGMLAALEFMADREARGPKVSAACLERGMIARAMPGDILGFAPPLVLSRAEADEVVGIAKAAVDAV 468
61 -80.8003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  30  2.......................................THDLIEKSKKHLWLPFTQMPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHSTLLMTNVPATQLAETLIDISKLTRVFYSDSGAEAMEIALKMAFQYWKNIG--KPEKQKFIAMKNGYHGDTIGAVSVGSIELFHHVYGPLMFESYKAPIPYLRELAQLLEEEEIAALSIESVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDYHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHAPHVGDIRQLGFMCGAELVRSKETKGYKVSLKMRELGMLTRPLG-DVIAFLPPLASTAEELSEMVAIMKQAIHEV 443
62 -80.1005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  25  2.........................TSETTTTPSRVPQTANDLLARRYATIGPHFYRQPLELVSGSGVWLTDAQGKVYLDGYNN--VPHVGHANPAVADAIYQQLLTVNLHTR-YLNSRVVEYAEALLSKFDLERLFLTNSGSEANELALRIARQH--------TGNTGVLVSDFSYHGNTTSLAEITTGLTVHEPLGAHVPDVSGIAEVDLADVDAAIASHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSMWGYQMFNVEPELVTMGKPMGNGH-PIGAVVTTAELLDEFRHNMFFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIRSGNVGSVRGRGLFFGIDIIESDGSRTKILIEDMRERGVLISRVGDNVLKMRPPLVFGREHADILLGQLELSLASL 438
63 -79.6004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  25  2..................................QKQRTTSQWRELDAAHHLHPFTDTARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFTTHPAVVELSSLLAEVTGFDRVFYTNSGSESVDTMIRMVRRYWDVQG--KPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDIGPYMQKRWRETRFEHVDDVRGVGMVQAFTLVKNKAKRGTLCRDIFFRNNLIMRACG-DHIVSAPPLVMTRAEVDEMLAVAERCLEEF 449
64 -78.3003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  25  1............................SSGLVPRGSHMTKALYDRDGAAIGNKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANPAGATILASNAPAVTLAERLLASFPGEKIWFGHSGSDANEAAYRAIVKA--------TGRSGVIAFAGAYHGCTVGSMAFSGHS--VQADAAKADGLILLPYPDLTEKLAAVPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCA-SAFAMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELRHPLIGDIRGRGLACGMELVCDRQSRTAKLIYRAYQLGLVVYYVGGNVLEFTPPLTITETDIHKALDLLDRAFSEL 432
65 -77.4005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  26  3....................................PAMAGNLYGRDGAAIGSKLRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANPAGASILASNAPAVALAERLTASFPGRKVWFGHSGSDANEAAYRAITRA--------TGRTGVIAFIGAYHGCTVGSMAFSGHS--VQADAAKADGLILLPYPDLKERLAAVPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCA-SAFAMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLRHELIGDIRGRGLACGVELVRNRQSRTAKLIYRAYELGLVLYYVGGNVLEMTPPLTMTEDEVRHAVNLLDQAFTEL 426
66 -76.8004a0f_A mol:protein length:831 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  17  301...............VESDGVFKALKETMVLANLERLERLNGMAKLAGEVFWWPYTQHKIDSRCGENFSIYKASLSQQFDACASWWTQGPDPTFAELAREMGYTAARFGHVM--NVYEPALKCAELLLDGVGASRVYFSDNGSTAIEIALKMAFRKFCVDHNFKHIVVKVIALRGSYHGDTLGAMEAQAPSPYTGFLQPWYTGRGLFL-KHLQEHSGVRQSAHVGALIIEPVHGAGGMHMVDPLFQRVLVNECRNRKIPVIFDEVFTGFWRLGVETTTELLGCKPDIACFAKLLTGGMVPLAVTLATDAVFDSFSGDSHGHSYSAHAMGCATAAKAIQWFKDPETNHNITSQGKTLRELWDE-SHSAVQRVVVIGTLFALELKADASNSAKSLLIMLREDGIFTRPLG-NVIYLMCGPCTSPEICRRLLTKLYKRLGEF 822
67 -55.0005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  18  9..................LARVETLFKRELRRFDELHPRSAQAYRENRRHWLYGPGNCPLLVKEAQGARVTDIDGQQYVDFALGDSGAMFGHAQPAVADAIARQARR---STLMLPTEDSLWVGAELARRFGLPYWQVTTSATDANRFVLRLCRML--------SGRDKVVVFNCNYHGSVDESQVEFDAAGRMVPRAGHATTTRLVEFNDLDALEAALAHGDVAAVLTEPFMTNVGMVPPAEGFHAGLRELTRRHDVALIIDETHT---SCGPAGYSGAHGLEPDFFVLGKCIAGGI-PSAVWGCSQAQAERIWA--FGGTLAGNALQLAAMRATFAEVMTEDAYRHMFQLAAQLEAGVRATELRLPWHVTRIGARVEYLFMTHAPRNGGEAHHALLNRGVLLTPFHNMALTCP---ATRAEDVELHDRLLRDCLGEL 456
68 -54.5002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  21  20........GEPGRSPASDTAEKAQAIAAARNTFARDNPVSAGHHERARRSMILFHRPFPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQ--TENEALFAEAVCDFPSIDLVRFTNSGTEANLMALATATAI--------TGRKTVLAFDGGYHGGLLNFASGHAPTN-------APYHVVLGVYNDVEGTADLLKRHDCAAILVEPMLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS--RLSGGGAQEMLGISADLTTLGKYIGGGM-SFGAFGGRRDLMERFDPARHAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIENQAPLQFTGLGSLGTIHFSRAPIRSAGDVRAAMLRKGIYLAPRGMYAL----SLEIADAGRDAFAEALADFIGEQ 454
69 -54.5005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  22  16....................................GSAAADLFERARRVLPGGSAPYPPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLADGVAFAMP--TEHEIALAELLTEVPSLQQVRFTNSGTEAVMMAIKAARAY--------TGRPRIAKFDGCYHGSYDFAEVSTQSSGKPGE-QAVLDSVVVLPFNDIDGTERLIEQDELAAVLIDPNPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVIS---RSDYGGMQSVLGVTPDLTAMGKIIGGGF-PVGAVGGSAEVMSVFDPTGHGGTFNANPVTMVAGLTAMRKL-TPAEFDRLATLGQQLRAGVEEVEAGVPGQVTGYGSLFHIHLHQRPLADYRNSVLSLMGRGIFITPALFGCLSTP-----GVPEVEAFVDAFAAALQDA 444
70 -54.3006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  19  4.....................................SSSENLYFQGGGHMTKNEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDA-VLERLHALCGGEVVGLFRSGTAAVRAAVLAVREA--------TGRPLLL--SAGYHGYDPMWYPSEAPLEPNA-------DGVVDFFFDLGLLRELLRPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV--SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKADASLPVEIAGDGTFFQFVPATEELEEA--LYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERL 387
71 -54.1002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  19  2....................SILNDYKRKTEGSVFWAQRARSVMPDGVTADTRAFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAAS--HPLEVRWAERIVAFPSIRKLRFTGSGTETTLLALRVARAF--------TGRRMILRFEGHYHGWHDFSASGYNSHFDGQPAPGVLPETLLIRPDDIEGMREVFANSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGL-PGGILGGREDVMGVLSRGSHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLRKGLNWLAYGRFSGFHLEVARPDVKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRL 435
72 -54.1006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  18  2...................GSSSSENLYFQGGGHMTIDIGAGKLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTA-WSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVR----------DARDRSIVLSSGYHGYDPMWHCDEPFTPNQHGI--------VEFLFDLDVLAEWLSPEQVAAVVISPDHMHLG-----ERWYTEFTRLTKEADVPVIADEVKVGL-RYRA--GLSTPLLDPAVWIVAKCLANGS-PVAAVGGDAHLLAALEDV--SFTSYFEPTAMAAATTTLRRMATGEPQQAIRAAGDRFIAHTRAANAGVPIDLAGNGNLFQFVCADDEVADA--FHAAAAAEGLLFFEGDNQTPSAA-----TDEVVEDACGRIDRVSAAL 388
73 -54.0006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  19  2....................SILNDYKRKTEGSVFWAQRARSVMPDGVTADTRVFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAAS--HPLEVRWAERIVAAFSIRKLRFTGSGTETTLLALRVARAF--------TGRRMILRIATHYHGWHDFSASGYNSHFDGQPAPGVLPETLLIRPDDIEGMREVFAQSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGL-PGGILGGREDVMGVLSRGSHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLRKGLNWLAYGRFSGFHLEVARPDVKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRL 435
74 -54.0006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  19  2......................................TKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDA-VLERLHALCGGEVVGLFRSGTAAVRAAVLAVREA--------TGRPLLL--SAGYHGYDPMWYPSEAPLEPNA-------DGVVDFFFDLGLLRELLRPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV--SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKADASLPVEIAGDGTFFQFVPATEELEEA--LYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERL 371
75 -53.4004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  23  4.....SSSGLVPRGSHMTHAAIDQALADAYRRFTDANPASQRQFEAQARYMVLFYAPFPLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGH--NLLEGRLARLICEFPQIEQLRFTNSGTEANLMALTAALHF--------TGRRKIVVFSGGYHGGVLGFGARPSPTT-------VPFDFLVLPYNDAQTARAQIERPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS--RLAPHGLANKLGIRSDLTTLGKYIGGGM-SFGAFGGRADVMALFDPRTHSGTFNNNVMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALNEGVAMQFTGIGSLMNAHFVQGDVRSSEDLAAHLLNEDIYSSPRGFVVL----SLPLTDADIDRYVAAIGSFIGGH 440

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.