current user: public

If you have questions about the server, please let us know.

Query: 1s69_A mol:protein length:124 Cyanoglobin, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MSTLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDVLNQLast
1 -71.8001s69_A mol:protein length:124 Cyanoglobin  ali model  100  1MSTLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDVLNQ 124
2 -69.3002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  59  1.ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNR 123
3 -63.8006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  42  1.STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLI--GVRPLFDPE 121
4 -63.2004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  43  8.DSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVA--SARPLIFGT 128
5 -60.4003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  47  5.QTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGM----NLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIE--HTRKDMLGK 121
6 -60.2002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  19  2..TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLV--YAAYAMVNV 121
7 -59.4002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  32  13.ISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGR----GITMHHFSLVAGHLADALTAAGVPSETITEILGVIA--PLAVDVTSG 129
8 -59.3001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  33  1..SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANM----GVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAE--TVRGDVVT. 115
9 -59.1001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  34  13.ISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGR----GITMHHFSLVAGHLADALTAAGVPSETITEILGVIA--PLAVDVTSG 129
10 -57.8004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  19  22.KTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLA--SHMINQ 144
11 -57.7001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  45  43.SSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDL--VPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVA--STRTEVLNM 161
12 -56.8005d1v_A mol:protein length:127 Globin  ali model follow..  30  4.PTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFR--HAAQAMMNR 123
13 -56.5001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  16  3.KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLE--MAAHSLVNS 126
14 -55.8002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  19  6.VTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVE--RLAFHMQNQ 128
15 -55.6004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  19  34.MTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLV--YAAYAMVNV 154
16 -55.3005v3t_A mol:protein length:132 Globin  ali model follow..  20  6.MTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLA--LTAQHMVNT 125
17 -55.0002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  23  3WQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLV--LTAHHMVNT 123
18 -47.9001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  24  5FNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTA--RHMVNQ 124
19 -46.7004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  17  25.SNLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTA--FFLVAG 147
20 -46.5004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  11  51.SKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFS--IRMINR 172
21 -42.2002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  14  1...MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLP----PFPQEFFEIWLKLFEESLNIVYNEE-MKNVILQRAQMIAFQNMLYKY 124
22 -14.7001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  19  9VMQSYGRCCASTGF---FDDFYRHFLASPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEH.......................... 105
23 -13.8004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  27..........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS......... 138
24 -13.8004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  32..........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS......... 143
25 -13.8002w31_A mol:protein length:162 GLOBIN  ali model follow..  14  29..........ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSNRYIHNLQKHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI......... 138
26 -13.5004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  15  74..........TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSQALIAQQKQEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISET......... 187
27 -13.1001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  11  59..........QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVDEFIEKRNRSIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKI......... 168
28 -12.5004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  18  32..........TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAA---FQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRD--AAQAAATCRYVADVTMTAVEMMSH 155
29 -12.2005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  14  34..........APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARL--PPELERVRNALGKVLDLELAVM.. 153
30 -11.0002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  10  50..........EDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA......... 177
31 -9.2604fm4_B mol:protein length:206 Nitrile hydratase beta subunit  ali model follow..  17  1MDGMHD-LGGKQGFGPVIKTHNAKAFHEEWEVKMNA--------------ISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGV........................ 85
32 -9.1203qxe_B mol:protein length:219 Co-type Nitrile Hydratase beta subunit  ali model follow..  20  1MNGIHD-TGGAHGYGPVYREPNEPVFRYDWEKTVMS--------------LLPALLANGNFNLDEFRHSIERMGPAHYLEGTYYEHWLHVFENLLVEKGV........................ 85

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.