current user: public

If you have questions about the server, please let us know.

Query: 1svv_A mol:protein length:359 THREONINE ALDOLASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MSTPRTTATAAKPKPYSFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAARLIGELLERPDADVHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLADIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLFFELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEPLKDGTCIMRLCTSWATEEKECHRFVEVLKRLVASTALast
1 -123.0001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model  100  1MSTPRTTATAAKPKPYSFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAARLIGELLERPDADVHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLADIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLFFELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEPLKDGTCIMRLCTSWATEEKECHRFVEVLKRLVASTA 359
2 -111.0005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  28  2...........TDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERASEYFRNLFETD-CEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLALLVSDLGVELMFPVEANGVFLQMPEHAIEALRAKGWRF---YTFIGSGGARFMCSWDTEEERVRELAADIRSIITA.. 346
3 -104.0003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  18  2..........SHMRYIDLRSDTVTQPTDAMRQCMLHAEVGDDV-YGEDPGVNALEAYGADLLGKEAA--LFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVR--ELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQ--HVVRLADDHRRARQLAEGLAALPGIRLAQVQTNMVFLQLTSGESAPLLAFMKARGILFSGYG--ELRLVTHLQIHDDDIEEVIDAFTEYLGA.. 341
4 -104.0001v72_A mol:protein length:356 Aldolase  ali model follow..  27  3........ETSRPPALGFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVKRKFCEIFERD-VEVFLVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNKLMTVDGPAAKLDIVRLRERTREKVGVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEMTWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDLWLRNARKANAAAQRLAQGLEGLGVEVLGGTEANILFCRLDSAMIDALLKAG--FGFYHDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ 354
5 -99.7003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  20  1..............MIDLRSDTVTRPSRAMLEAMMAAPVGDDV-YGDDPTVNALQDYAAELSGKEAA--IFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELK--EITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDN--AAWMAEQLREAGAD-VMRQDTNMLFVRVGEENAAALGEYMKARNVLI--NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR.. 333
6 -98.1004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  19  1..............MIDLRSDTVTRPSRAMLEAMMAAPVGDDV-YGDDPTVNALQDYAAELSGKEAA--IFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELK--EITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQEDHDN--TAWMAEQLREAGAD-VMRQDTNMLFVRVGEENAAALGEYMKARNVLI--NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR.. 333
7 -92.1002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  16  2.........GSDKIMIDLRSDTVTKPTEEMRKAMAQAEVGDDV-YGEDPTINELERLAAETFGKEAA--LFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGMPHPVPGKNGAMDPDDVRKAIRPRNHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVK--EYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDR--LKEDHENARFLALKLKEIGYSVPEDVKTNMVILRTDNLKVNGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS 349
8 -74.0003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  16  7..........TSFQQTTGQISGHGKRNVKTAFAAVADEMASDQ-YGTGAIIEPFEQKFADVLGMDDA--VFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQDGLKELHPETILVGAADRLMTLDEIKAL-------PDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAA--EIAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRK--DRMGQYYEQAKQLAEQFNALPGVHTEVPVSNMFHLHFDGDISPKLEQVQEETGLGFVGLVDKDGYCSTEISVGDAYGELDQQTRDAGFARLR 353
9 -72.8003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  18  3....TNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNDNLESDI-YGNGAVIEDFETKIAKILGKQSA--VFFPSGTMAQQIALRIWAKENRRVAYHPLSHLEIHEQDGLKELQQTPLLLGTANQLLTIDDIKSL------REPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAE--EICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEA--AKGLAERFNSCSGVKTVPPVSNMFHVYFENEIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAKNLELVFRCLEKE.. 358
10 -51.2001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  11  34....NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMG---DEAYAGSENFYHLERTVQELFGFKHI--VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDGDIDLKKLQKLI---DEKGAENIAYICLAVTVNLGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLEHHRPKLETVRLTIPRRVTYAHMDVVADGIIKLYQHKE 432
11 -50.2006MME Entity 1(prereleased)  ali follow..  11  34....NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMG---DEAYAGSENFYHLERTVQELFGFKHI--VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDGDIDLKKLQKLI---DEKGAENIAYICLAVTVNLGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRSMERGIITYAHMDVVADGIIKLYQHKE 432
12 -48.9001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  11  40..........SKDIYIDLLTDSGTNAMSDKQWAGMMIG---DEAYAGSENFYHLEKTVKELFGFKHI--VPTHQGRGAENLLSQLAIKPGQYVAGNMTTTRFHQEKNGATFVDIVRDEAHDASLNLPFKDLNKLATLIKEKGAENIAYICLAVTVNLGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQEAVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYERVKQVRYLGDKLREAGVPIVEPTGGHAVFLDARRFCPHLTQDQFPAQSLAAHRPKLETVRLTIPRRVTYAHMDVVADGIIKLYQHKE 432
13 -47.4001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  12  29LKEAGYNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDE-AYAGSRNYYDLKDKAKELFNYDYI--IPAHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFAAHVELNGCKAINIVTEKGDFDIKKLKENIAQHGADN-IVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARDPIFDMYKYADALTMSAKKDPLLNIGGLVADNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYPTGGHAVFVDCKKLVPQIPGDQFPAQAVINKHADMEFMRLTIARRVTNDHMDYIADALIGLKEKFA 442
14 -46.9002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  12  42.........DSEDVFIDLLTDSGTGAVTQSMQAAMMRG---DEAYSGSRSYYALAESVKNIFGYQYT--IPTHQGRGAEQIYIPVLIKKREQEKGLDRSNYFFDTTQGHSQINGCTVRNVYIKGNFDLEGLERGIEEVGPNN-VPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREATRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLYGGLEGGAMERLA--VGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVV-CQQAGGHAAFVDAGKLLPHIPADQFPAQALACLPCPAELLRLTIPRATTQTHMDFIIEAFKHVKENAS 447
15 -30.9003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  14  33................NIFGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTKLLEEKAGSLLNNKDAYGHIVSGGTEANLMALRCIKNIWREIIVPITAHFSFEKGREMMDLEYIYAPI-KEDYTIDEKFVKDAVEDYD-----VDGIIGIAGTTELGTI---DNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKYKKKDFSLGVDSITIDPHKMGHCPSGGILFKDIGYKRYLDVDAPYLTETRTRVGFGGACTYAVLRY--QRKIVNECMENTLYLYKKLKENNFKPVIEPILNIVAIEDEDY--KEVCKKLRDRGIYVSVNCVKALRIVVMPHIKREHIDNFIEILNSIKRD.. 397
16 -26.5005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  10  65.................FCQTYMEPEAVELMKDTLEKNAIDKSEY---PRTAEIENRCVNIIANESFTGTSTIGSSEACMLAGLAMKFAWRKIVISAGYQVCWEKFCVYWDIDMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARL---DAVVERYNRTTKFPVYIHVDAASGGFYTPFIEPELKWDFRLNNVISINASGHKYGLVYPGVVIWRDQQYLPKELVFKSYLGGELPTMAINFSHNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGFSLINDGHELPLICYEREWTLYDLSDRLLMKGWQVPTTDRVIQRIVVRADFGMSMAHDFIDDLTQAIHD.. 447
17 -25.8004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  12  103.............................LVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSPDSCGCVTSGGTESILMACKAYRDLAFEIVAPQSAHAAFNKAASYFGMKIVRVPL-TKMMEVDVRAMRRAISRNT-------MLVCSTPQFPHGVI---DPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLE-VKGVTSISADTHKYGYAPSSLVLYSDKKYRNYQIYASPTIAGSRPGGISAACAALMHFGENGYVEATKQIIKTARFLKSELENIGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQQFPPSIHFITLLHARKRVAIQFLKDIRESVTQ.. 453
18 -25.8003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  12  84.............................QTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRDTGCGTTTSGGTESLLLACLSAKMYALHIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNT--------LVGSAPNFPHGIA---DDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKN--VPGVTSISCDTHKYGFAPKGSIMYRNSDLRMHQYYVNPATGGLYGSPTLAGSRTMVNMGENGYIESCQEIVGAAMKFKKYIQENDLDIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQE.. 436
19 -25.1005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  10  46...........TREFINLNPIQRGGILPEAKKAVYEDYCHGRLDEVTCPPIKDFLEDIAKFLNMDCA--RPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEPTYKINLEGYKEVIDNLEDKG-KNVGLILLTHVDGYGNLND---AKKVGKIAKEKGIPFLLNCAY---TVGRMPVNGKEVK----ADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEMLGCTSRGLPIVTASFPHVVERV---KKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFYDE-GVTKEIKMSYGLEWEQVEYVVNAIKEIVES.. 409
20 -24.7002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  106...............................IGRSGNLVDPQPKASGASIMYALTNKIFKQLGNVHAIATPISTGMSISLCLSAARKKYGSVVIYPYASHKSPIKAVSFVGMNMRLVETVLDGDYVPVEDIENAIKKEIELGNR-PCVLSTLTFFPPRNS---DDIVEIAKICENYDIPHIINGA--YAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGVYSTDAEFIKEISLSYPGRASATPVVNTLVS--LLSMGSKNYLELVKNQKNSKKLLDELLNDLGGKFLDVESPIASCISVNSDPVEAKLYNLRVTGPRGIKKTDDYIVMNAAIGVRTEDIVNSVSKLEKIL.... 449
21 -24.7004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  114...........................TELLKEVYGATALTNPLHDKWPRINAMQAEVIRWCQNKEGYGLLTHGGTTSIIEAMAAYVIRARAIVVPETAHAAFKKAAELTGAILITVPVDKKTGAVNPNVMSSYITRN------TAVMVGSAPSFMNGIH---DPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMDFRPGVTSISADLHKYGCCPTSVCLFSEDSPALSVYAALNWSGGLYSGARVAEVATLSYYGKNKYQEIAKSIIRLRNAIQKELTALDIYVYGNPQWSILGFRSNTCNAHFIADELEKRGWKLNLLQN-HLCLTHVHTLVGSFETQFIKDLREAVID.. 473
22 -24.2003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  64.....................VTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHETAVGVGTVGSSEAIMLAGLAFKRKWQNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENT--------VAAILGSTLNGEF---EDVKLLNDLLVEKNKEIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIVIWRNKEDLPEELIFHINYLGAFSKGSSQVIAQYYQLIR--YRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSSCHTEFEISDMLRRYGWIVPAQHITVLRVVIREDFSRTLAERLVIDIEKVMRE.. 443
23 -24.0002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  13  117.............................AAEAMIAALNQSMDSWDQASSATYVEQKVVNWLCDEKADGIFTSGGTQSNQMGLMLARDW--RIVCSKKSHFTVQKSASWMGLGEKAVMTVDANGTMDITKLDEVIAQAKAEGLIPFAIVGTAGTTDHGAI---DDLDFIADMAVKHDMWMHVDGA--YGGALILSSHKSRLKGVERAHSISVDFHKLFYQTCGALLVNDKSNFKFLLHHADYL-ATTKRFDALKV-TMQNVGPKALGDMYDHLLAQTLEVADMIRT-QFELLAEPSLSTVLFELNKALRLEALTRGIAVLGETIVDGKTALKFILNPCLTTSDFESLLSKINMLAVE.. 495
24 -23.9004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  16  104.............................LGDLVAAAVNNNMLSLEMSPSFSRLETLLLRAIAGEQAGGVLTSGGSLANLQALAVARNV--VIFASEAAHTSLQKAAMLLGLGTAAVIPVRATSRMDPEDLRARIDQARGAGQHPFCVVATAGTTTTGNI---DPLAEIGAIAREHGLWFHVDAAYGGALVFSERHRWRLAGIEQ-ADSITFNPQKWLYVACAMVLFRDAGVLERAFRIPARHADVVKLWLTLQHIGQQGYARLI-----DDGYRLAERVVEGVRQRPLRLAGEIDTNIVCFDWNAALQALLLREGKIFLSLPVYRGGRWLRALLNPYTTDAVIDAMFKQIDRFAGR.. 480
25 -23.8005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  13  68.............................LNEAYGLFSHVNALQRDLCPSMNRMESEIVAMTGAHRACGALSLGGTESILNATLAYREKARAMIWPASAHPAFRKAAHLFGFDVTVAPIDPVTMQVDADFVRDAVDANT--------LVGSACNYPYGTI---DPIGALSAIAVEKDVWLHVDGC-LGGWMLPWGEALGYPDIPPGVTSISADTHKFGYGPKGGLAWRDASFRRHQYFLMTGLTGSRSGGLIAATAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGKPTFCFAFTSDAFDIYHVNDFMRQRGWRFNGQHPDALHMVTGPQTQPGVAERFRQDLGEAVEH.. 427
26 -23.6004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  15  109.............................LGDIMTSAYNIHAGGSKLAPMVNCIEQEVLKWLAKENPGGVFVSGGSMANITALTAARDN--TAYISDQTHSSVAKGLRIIGITDSRIRRIPTNSQMDTTKLEEAIETDKKSGYIPFVVIGTAGTTNTGSI---DPLTEISALCKKHDMWFHIDGAYGASVLLSPKYKSLLTGTGL-ADSISWDAHKWLFQTCAMVLVKDIRNLFHSFHVNPEY-ELTRPARGLKL-TLQVLGSDLIGSAIEHGFQLAVWAEEALNPKDWEIVSPAQMAMINFILNEKISHRILESGYAAIFTTVLNGKTVLRIAIHPEATQEDMQHTIDLLDQYGRE.. 482
27 -23.3003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  14  90.............................LADMLCGAIGCIGFSWAASPACTELETVMGKMLELPKGGGVIQGSASEATLVALLAARTK--VAYSSDQAHSSVERAGLIGGVKLKAIPS-DGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSF---DNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEF-ADSFNFNPHKWLLVNCSAMWVKKRTDLTGAFRLDPPLGRRFRSLKMFRMYGVKGLQAYI-----RKHVQLSHEFESLVRQ-RFEICVEVILGLVCFKVNEALLQRINSAKKIHLVPCHLRDKFVLRFICSRTVESAHVQRAWEHIKELAAD.. 473
28 -23.2001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  14  90.............................LADMLCGAIGCIGFSWAASPACTELETVMGKMLQLPEGGGVIQGSASEATLVALLAARTK--VAYASDQAHSSVERAGLIGGVKLKAIPS-DGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSF---DNLLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLNGVEF-ADSFNFNPHKWLLVNCSAMWVKRRTDLTGAFKLDPPLGRRFRSLKMFRMYGVKGLQAYI-----RKHVQLSHEFEAFVLQ-RFEVCAEVTLGLVCFGLNEALLERINSARKIHLVPCRLRGQFVLRFICSRKVESGHVRLAWEHIRGLAAE.. 473
29 -23.2002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  11  23...........................EEARQALLECTTGRLDEIKTPPIHDFIHNQLPKFLGCDVA--RVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYV--AAERAGLNIALVPYPDYAITPENFAQTIEETKKRGEVVLALI-TYPDGNYGNL---PDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI-------GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVEGCTARGATIITLMASFPHVREDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKKLKSRKIHGIKPGLTRYFKLSTYGLSDEEVDYVLNAFKEIIEKYS 371
30 -23.2003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  14  90.............................VADMLSGAIACIGFTWIASPACTELEVVMGKMLELPAGGGVIQGTASESTLVALLGAKAK--VGYCSDQAHSSVERAGLLGGVKLRSVQSENHR--MRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAF---DYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIES-ADSFNFNPHKWMLVNCSAMWLKDPSWVVNAFNVDPRRFRALKLWFVLRLYGVENLQAHI-----RRHCNFAKQFGDLCVA-RFELAAEINMGLVCFERNEALLKRINGRGHIHLVPAKIKDVYFLRMICSRFTQSEDMEYSWKEVSAAADE.. 470
31 -23.1004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  15  95.............................LGDMLADAINCLGFTWASSPACTELEMNVAKMLGLPEGGGVLQSTVSESTLIALLAARKN--VAYASDQAHSSVEKAGLISLVKMKFLPV-DDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAF---DCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEY-ADSFTFNPSKWMMVHCTGFWVKDKYKLQQTFSVNPRRFRSVKLWFVIRSFGVKNLQAHV-----RHGTEMAKYFESLVRN-SFEIPAKRHLGLVVFSLTENVLKEIAKAGRLFLIPATIQDKLIIRFVTSQFTTRDDILRDWNLIRDAATL.. 477
32 -23.0005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  17  120.............................LAEQIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLSAGADGIFTSGGTQSNLMAMLLARDSW-RVFTSKLSHFSIQKSMAILGLGYDAVIPVDYDYRMDVDCLKQEVQRCLQQGLIPVAVVATSGTTDFGSI---DPLGAISELCKHHGMWMHVDAAYGCGLLVSESHRPRLAGIEK-ADSVTVDYHKSFFQTCGAFFVRDKHHLSHVTHHADRRFDALKMWLTLRVSGPMALGNAF-----DDILALTQIAHQLLNA-AIEVLHVPELTTQIFEINTNIRKAVFRSGNAVIAGTKVNGRQYLKFLLNPNTTAADIEDVIALIVHYGRE.. 507
33 -23.0001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  12  46INDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEY---PQSAAIDLRCVNMVADAPKNGQAVGTNTIGSSEACMLGGMAMKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDEN------TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGFSRPAGQVIAQYYEFLGREGYTKVQNASYQVAAYLADEIAKLGYEFICTGRPDEGIPAVPGYTLYDLSERLRLRGWQVPATDIVVMRIMCRRGFEMDFAELLLEDYKASLKY.. 447
34 -22.8001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  12  46INDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEY---PQSAAIDLRCVNMVADAPKNGQAVGTNTIGSSEACMLGGMAMKWNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDEN------TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGFSRPAGQVIAQYYEFLGREGYTKVQNASYQVAAYLADEIAKLGYEFICTGRPDEGIPAVPGYTLYDLSERLRLRGWQVPATDIVVMRIMCRRGFEMDFAELLLEDYKASLKY.. 447
35 -22.7006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  13  106.............................LGELLCSGLSVIGFTWSSSPAATELENVVAKMLNLPSGGGVLQANTCEAVLCTLAAARDK--VLYCSDQTHFTIHKGAKLIGIRSKNIKSITTKKKLCPNDLRDAIRSDLEAGLVPFYVCGTIGTTALGVV---DPIKELGKVAREFDLWLHVDGAYGGSACICPEFQHYLDGVDL-VDSISMNAHKWLLSNCCFLWLQSPNALIESLAAEARRFRAIKMWMVIRRYGVSNLIEHI-----RSDVSMAVRFEEMVAA-RFEIVFPRKFALVCFELTRELMERVNSSGKAYLSGVQMGRIFFIRCIGSSLTEERHVDNLWRLIQETAQS.. 487
36 -22.3003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  12  120.............................LNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAGGTVCGTVTSGGTESLLLAMKTYRDWARAAVVPVSAHAAFDKAAQYFGIKLVRTPL-DADYRADVAAMREAITPNT--------VAGSAPGYPHGVV---DPIPEIAALAAEHGIGCHVDAC--LGGFILPWAERLGYPVPEGVTSVSADTHKYGYGATSVILYRRPDLLHYQLYFSPTFAGSRPGALSATAAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDELNIYQVMEEMAGRGWRLNGLHPPAFHVLTLRHTEPGVVDRFLADLQDAVAQ.. 472
37 -22.1002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  17  119.............................AGRIITESLNTSQYTYEIAPVFVLMEEEVRALVGWSSGDGIFCPGGSISNMYAVNLARYQ--ALFTSKECHYSIQKGAAFLGLGTDSVRVVKADGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAF---DPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQR-ADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDMWKAQGDQGLERRI-----DQAFVLARYLVEEMKK-GFELVMEPEFVNVCFKVAPVLKERMVKEGSMMGYQPHGTRGNFFRVVANSALTCADMDFLLNELERLGQD.. 508
38 -22.0006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  11  101.............................LGEMLSAGLGIVGFSWVTSPAATELEMIVLDWVAKEQFMSKGNGGGVIQGSASEAVLVVLIAAVYSSDQTHSALQKACQIAGIHPENCRVLSTNYALRPESLQEAVSRDLEAGLIPFFLCANVGTTSSTAV---DPLAALGKIANSNGIWFHVDAAYAGSACICPEYRQYIDGVET-ADSFNMNAHKWFLTNCSLLWVKDQDSLTLALSTNPPLGRRFRSLKLLRLYGSETLKSYI-----RNHIKLAKEFEQLVSQ-NFEIVTPRIFALVCFNRNRELLDAVNSSGKLFMSHTALSGKIVLRCIGAPLTEEKHVKEAWKIIQEEASY.. 486
39 -21.9005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  13  109...................DEHHIAFLNEVYALQSQSNPLHPDLW---PSTAKFEAEVVAMTAGGTVCGTVTSGGTESLLLAMKTYRDWARAAVVPVSAHAAFDKAAQYFGIKLVRTPL-DADYRADVAAMREAITPNT--------VAGSAPGFPHGVV---DPIPEIAALAAEHGIGCHVDAC--LGGFILPWAERLGYPVPEGVTSVSADTHKYGYGAKGTILYRRPDLLHYQYFIAASPTFAGSRPGALSATAWAAMLS--YLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDELNIYQVMEEMAGRGWRLNGLHPPAFHVLTLRHTEPGVVDRFLADLQDAVAQ.. 468
40 -21.8006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  13  111.............................LGEMLSTALNSVGFTWVSSPAATELEMIVMDWLAQKSFMFSGTGGGVIQNTTSESILCTIIAACYGSDQTHTMFPKTCKLAGIYPNNIRLIPTTVGISPQVLRKMVEDDVAAGYVPLFLCATLGTTSTTAT---DPVDSLSEIANEFGIWIHVDAAYAGSACICPEFRHYLDGIER-VDSLSLSPHKWLLAYCTCLWVKQPHLLLRALTTNPRKFRSLKLWLILRSYGVVNLQSHI-----RSDVAMAKMFEEWVRS-RFEIVVPRNFSLVCFEVNKKLLDMLNSTGRVYMTHTIVGGIYMLRLVGSSLTEEHHVRRVWDLIQKLTDD.. 495
41 -21.7006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  15  134.............................AARIITEALNPSIYTYEVSPVFLLVEEAVIECVGWKEGDGIFNPGGSVSNMCAMNLARYR--ILFTSAECHYSMKKAASFLGIGTQNVYFVETDGKMIPEDLEKQIWQARQEGAVPFLVCATSGTTVLGAF---DPLDEIAEVCERHGLWLHVDASWGGSALVSRKHRRLLHGIHR-ADSVAWNPHKMLMAGIQCSALLVKDKSDLLKKCYSAKATYLFQQDTWKALGTSGLEERV-----NRAFALSRYLVDEIKK-GFKLLMEPEYTNVCFLVAPAIKEKMMKKGSLMGYQPHRGKVNFFRQVISPQVSREDMDFLLDEIDSLGRD.. 523
42 -21.7004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  14  2.............AMIYLDHNATTFIDPRVKEFIINPSSAHSSGRFAKNLIETVRAQIATALGSREYDITFTSSGTEGNNLIMKNFYD--GDIFISAIEHLSIYN--HINYAPNIKVISVNTQGLVDLEHLEELLAQSN----TSKKLVSII-NNESGVLQD---IAEIGKITKKYEAKFHSDLVQ---GFGRIPINIKAL----GLDFATISGHKIGGGQGGAALISSSNMIIGGGQEKSVRSGTENVLAIAGFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSNNVNTTLITIPNTDAQAKLIGFDLHNICVSSGSKSSIRISLSHTNTVRDIEAFIEAFEEIYDV.. 371
43 -21.4001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  12  15............ANKTYFNFGGQGILPTVALEAITAGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGDIVLWGLDWHQGDEILLTDCEH-AIAARFGITY--RFFPVAATLNQGDAAAVLANHLG-------PKTRLVILSHLWNTGQVLP---LAEIMAVCRRHQVRVLVDGAQ---SAGSLPLDFSRLE----VDYYAFTGHKWFAGPAGGGLYIHGDCLGEIN--KRFEVATSAYPQYLLAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCLAPQAGLVSFTVDSLGHRAIVQKLEEQRIYLRTIADDCIRACCHYITDEEEINHLLARLADFG.... 389
44 -20.9006eem_A mol:protein length:512 Tyrosine/dopa decarboxylase  ali model follow..  15  109.............................LGEMLSTGFNVVGFNWMSSPAATELESIVGQMLTLPKSDGSSGGGGVLQGTTCEAILCTLTAAVYASDQTHCALQKAAQIAGINPKNVRAIKTSKGLSPNSLQSAILADIESGLVPLFLCATVGTTSSTAV---DPIGPLCAVAKLYGIWVHIDAAYAGSACICPEFRHFIDGVED-ADSFSLNAHKWFFTTCCCLWVKDSDSLVKALSTSPALSRRFRSMKLLRSYGVANLRTFL-----RSHVKMAKHFQGLIGM-RFEIVVPRTFAMVCFEVNVKLLESVNASGKIYMTHAVVGGVYMIRFVGATLTEERHVTGAWKVVQEHTDA.. 508
45 -20.8002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  15  105.............................AADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREGSGDGIFSPGGAISNMYAMMIARFK--IAFTSEHSHFSLKKGAAALGIGTDSVILIKCDGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAF---DPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVER-ANSVTWNPHKMMGVPCSALLVREEGLMQNCNQMHARHVDVFKLWLMWRAKGTTGFEAHV-----DKCLELAEYLYNIIKNREMVFDGKPQHTNVCFKVAPVIKARMMEYGTTMSYQPLGDKVNFFRMISNPAATHQDIDFLIEEIERLGQD.. 497
46 -20.8005i90_A mol:protein length:427 PvdN  ali model follow..  15  51............PQYLHFANFLLTSHPRPVREAIERLRVRFDRNPGEWKYEDEARAWAGRYFAVQPGQVALTGSTTDGAAIYGGLLVQPGKEILTSSHEHYSTYTT--RHKRMGTQVREFPLFKDPHRVSADEILSSIAAQIRPQTRVLGMTWQSGSGVKLPIREIGKLVR-DEQDRIIYVVDGVH---GFGVEDVSFADFD----CDYFIAGTHKWLFGPRGGVIIARSEQLQEH---LMTPGGYHAFEHRLALGTAFELHLQL--EVQARIHQLNAYLKQRLGEHPKVRLVTPTSGFTFFRVEGRDCEAVAKHLMAHRVISDAVDRPVVRLAPSLLNDEAEIDRVLEILAPQLA... 427
47 -20.8004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  14  1..............MAYFDYTSAKPVDERILEAMLNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGYARKGKHILVSAVEHMSVINAKFLQKQGFEVEYIVGKYGEVDVSFIDQKLRDD-------TILVSVQHNNEIGTIQP---VEEISEVLAGKAA-LHIDATA---SVGQIEVDVEKI----GADMLTISSNDIYGPKGVGALWIRKEVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESYLNGHPENNVNVRFSYIEGESIVLSLDMAGIQASTGSHGTLLLTLGRYNTDEDVDRLLEVLPGVIER.. 372
48 -20.7001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  13  34.AQQADITVADGSHVINFCANNYLG-HPDLIAAAKAGMASVRFICGTQDSHKELEQKLAAFLGMEDA--ILYSSCFDANGGLFETLLGAEDAIISDALNHASIID--GVRLCKAKRYRYANND----MQELEARLKEAREAGARHVLIATDGVFSMDGVIAN---LKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLE-----ELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQ.. 396
49 -20.6003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  16  15...SGCGKHNSPERKVYMDYNATTPLEPEVIQAMTNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHAFITSSVEH-HLVEEQVAAVT---FVPVSKVSGQTEVDDILAAVRPT-------TRLVTI--NNETGIVMPVPEISQRIKALNQEPILVHTDAAQ---ALGKQRVDVEDL----GVDFLTIVGHKFYGPRIGALYIRGLGMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSNTCNFSIRGPRLQGHVVLAQCRVLMASVGARNALRLSVGRSTTRAEVDLVVQDLKQAVAQ.. 435
50 -20.6001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  16  22.........AQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPD--AFLAGAKARLVRPEGFRLDLSALEKALT-------PRTRALLLNTPMNTGLVFGERELEAIARLARAHDLFLISD--EVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVIVGPKEFMPRLAGMRQWT--SFSAPTPLQAGVAEALKEGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPGWDAFRLVEEARVALI-LEDPPKDLFRF--AFCKTEEELHLALERLGRVVNS.. 370
51 -20.5003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  15  112.............................AGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREKDGDGIFSPGGAISNMYSIMAARYK--VLFTSEQSHYSIKKAGAALGFGTDNVILIKCNGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAF---DPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIER-ANSVTWNPHKMMGVLCSAILVKEKGILQGCNQMHARHVDIFKFWLMWKAKGTVGFENQI-----NKCLELAEYLYAKIKNFEMVFNGEPEHTNVCFKVAPKIKALMMESGTTMGYQPQGDKANFFRMISNPAATQSDIDFLIEEIERLGQD.. 504
52 -20.5003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  15  1MGSSGSMYGVYRAMKLPIYLDYTTPVDPRVAEKMMQASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAAKKGKHIITSKTEHKAVLDCRQLEREGFEVTYLPQRNGIIDLKELEAAMRDD-------TILVSIMHNNEIGVVQD---IAAIGEMCRARGIIYHVDATQ---SVGKLPIDLSQLK----VDLMSFSGHKIYGPKGIGALYVRRKQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASSSIRFSLGRFTTEEEIDYTIELVRKSIGR.. 392
53 -20.4003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  12  32.SPQNAEIKVGEKEVLNFCANNYLG-HPALIKTAQTVMASVRFICGTQTIHKELEKDISEFLGTDDT--ILYSSCFDANGGLFETLLGPEDAIISDELNHASIID--GIRLCKAQRYRYKNNA----MGDLEAKLKEADEKGARFKLIATDGVFSMDGIIAD---LKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLEKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKK.. 395
54 -20.4003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  11  32.SKQDTEVKIDGRRVLMFGSNSYLG-DTRIIKAAQDACAGSRFLNGTLDIHVELEEKLSAYVGKEAA--ILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIID--GSRLSFSKVIKYGHNN----MEDLRAKLSRLPEDS---AKLICTD------GIFSMENLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHGLNDDVDLIMGTFSKSLAS-LGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALE-----EHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQ.. 391
55 -20.3002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  12  37..........ASPDDIILQSNDYLA-HPLIKARLAKSLFMSASFLQNDYDKPMIEKRLAKFTGFDEC--LLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWE--GARYANAQAHPFMHNN----CDHLRMLIQRHGPGIIVVDSIYSTLG--------TIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAEGLTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLE-----NRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLET--DERNTEKVRDYLESNGVFGTSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNY.. 383
56 -20.2003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  13  1MGSSSSGLVPRGSHMTYLDAAATTRVDQRVADIVLNAGSRHEYGIRAKRGVERAREYLASTVSAEPDELIFTSGATESNNIALLGLAPYGERIITSAIEHKAVLELEHLAGRGFEVDFLPGPSGRISVEGVMERLRPD-------TLLVSLMHNNETGVIQP---VAELAQQLRATPTYLHVDAAQGYGKV--------PGDLTTPIDMISISGHKIGAPKGVGALVTRRRIMFGGGQERKLRPGTLPVPLIMGLAEAAKIFEAEHAQWQVAAQDLRSRLLAGLASTSFQVFEDVDAEAFLVTLKDLVAVATGSASTSASFTPSEAASKSLRFWTPGQATDLDVEELARGVAKL..... 390
57 -20.2001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  13  37..........DDRQYLNFSSNDYLG-HPQIIRAWQQGSGGSGHVSGYSVVHQALEEELAEWLGYSRA--LLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLE--AASLSPSQLRRFAHND----VTHLARLLASPCP----GQQMVVTE------GVFSMDPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCW-LQKVKPELLVVTFGKGFGV-SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLASDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVVPAGTARLRLTLTAAHEMQDIDRLLEVLHGN..... 383
58 -20.1004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  17  1.........MRGSGSAYLDHAATTPMHPAAIEAMANASSLHTSGRSARRRIEEARELIADKLGARPSEVIFTAGGTESDNLAVKGIYWARRDIVTTEVEHHAVLDS--VEHEGAHVTWLTAADGSVSATALREALQSHDD-----VALVSV--NNEVGTILP---IAEMSVVAMEFGVPMHSDAIQ---AVGQLPLDFGAS----GLSAMSVAGHKFGGPPGVGALLLRRDLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVLALNGADDPMRLAGNAHFTFRGCEGDALLMLLDANGIECSTGSRGSLRLSLGHTSVEADVDAALEVLPGAVAR.. 385
59 -20.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  14  42..........NGRKTILLGTYNYMG-DPDVIAAGKQATTGSRVLNGTYQGHKACEDALKEFYGTEHA--IVFSTGYQANLGMISTLAGKGDYIILDADSHASIYD--GCWLGDAEIVRFRHNS----VEDLDKRLGRLPAEA---GKLVVLE------GVYSMMPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEGVEADVDFVVGTFSKSVGT-VGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIR-----DKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVIDMAQAVALWQGLLEAGLYVTPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATG 396
60 -19.9003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  12  51..........ASPDDIILQSNDYLA-HPLIKARLAKSLFMSASFLQNDYDKPMIEKRLAKFTGFDEC--LLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWE--GARYANAQAHPFMHNN----CDHLRMLIQRHGPGIIVVDSIYSTLG--------TIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAEGLTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLE-----NRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLET--DERNTEKVRDYLESNGVFGTSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNY.. 397
61 -19.9003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  16  6.NGARGSVESPPNRKVYMDYNATTPLEPEVIQAVTNPSSSYVAGRKAKDIINTARASLAKMIGGKPQDIIFTSGGTESNNLVIHSTVRCFHEFITCTVEHDSIRLP-EDQVAEVTFVPVSKVNGQVEVEDILAAVRPT-------TCLVTI--NNETGVIMP---ISEISRRIKALNVLVHTDAAQ---ALGKRRVDVEDL----GVDFLTIVGHKFYGPRIGALYVRGVGMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLEERLEAESRFPGVERLPNTCNFSIQGSQLRGYMVLAQCQTLLASVGARNAVRLSVGRSTTRAEVDLIVQDLKQAVNQ.. 427
62 -19.8001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  17  3...............VYFDNNATTRVDDRVLEEMINPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVAKRKRTIITTPIEHKAVLET-YLSMKGFKVKYVVDSRGVVKLEELEKLVDED-------TFLVSIMANNEVGTIQPVEDVTRIVK-KKNKETLVHVDAVQ---TIGKIPFSLEKLE----VDYASFSAHKFHGPKGVGITYIRKGLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEINTLSVSFPNIRGSTLQNLLSGYGIYVSTSSQGAIRISLCKYNTEEEVDYFLKKIEEILSF.. 375
63 -19.7005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  15  39..........DGRAIIGFASNDYLG-HPQLIAAIAEGSGGSHLLGGHSRAHAQLEDDLAEFVGVENARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLID--GARLSRADVQIYPHCD----TDALSAMLEASDA----DVKVIVSD------TVFSMDPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQALRSPNLISIGTLDKAAGV-SGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRGEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLIIGANDATLEIAATLDRAGLWVVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA 396
64 -19.6004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  15  32................NITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVEELSKELFKAEHANV--PTSGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPPEEMNIDADAMVKKILEE------KPKLILFGGS----LFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAG---KQFQDPLREGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAELEFGEAYAKQVIKNAKALAQALYERGFNVLCETESHQVIIDIESSPDIEFSASELAKMYEEAN-NPSGIRLCTRLGMKEKEMEEIAEFMKRIAIDKE 394
65 -19.6002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  14  62..........RGKDTILLGTYNYMG-DPDVIAAGKEATNGSRMLNGTFHDHMEVEQALRDFYGTTGA--IVFSTGYMANLGIISTLAGKGEYVILDADSHASIYD--GCQQGNAEIVRFRHNS----VEDLDKRLGRLPKEP---AKLVVLE------GVYSMLPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAGLEGQIDFVVGTFSKSVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIR-----EKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMDQEQAAMMWQALLDGGLYVTPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRA.. 414
66 -19.6003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  79..................RSGDISAVQPKA--------AGSSLLNKITNSLVLNVIKLAGVHSVASC--FVVPMATGMSFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVGDELRTDLKAVEAKIQELGPE---HILCLHSTTACFAPRV--PDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLIQQGARVGR-IDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLIT--LLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHLLQTPHNPISLAMTLKTIDGHHDKFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNI.. 442
67 -19.6002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  13  25LVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFIN-------ERTKGIVLSNPCNTGVVYGKDEMRYLVEIAERHGLFLIVD--EVYSEIVFRGEFASALSIESDKVVVIDSVSKKFSACGARVLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSAFYITAELPVEDAEEFARWMLTDF-LTPGLGKKEIRI--ACVLEKDLLSRAIDVLMEGLKM.. 395
68 -19.4004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  13  78..........RGKDTILLGTYNYMG-DPDVIAAGKEATNGSRMLNGTFHDHMEVEQALRDFYGTTGA--IVFSTGYMANLGIISTLAGKGEYVILDADSHASIYD--GCQQGNAEIVRFRHNS----VEDLDKRLGRLPKEP---AKLVVLE------GVYSMLPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAGLEGQIDFVVGTFSASVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIR-----EKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMDQEQAAMMWQALLDGGLYVTPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVG 432
69 -19.4005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  16  37..........NGREIVGFASNDYLG-HPKLVAAFAEGSGGSHLLGGHSRAHAKLEDELAGFAGSDAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLID--GTRLSRATVQVYPHAD----TATLGALLEACTS----QTKLIVTD------TVFSMDPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAALRSPHLVYVGTLGXAAGV-AGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKGDEGDARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVIGSNEATLAAMRALDAHGLWVVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA. 393
70 -19.3003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  14  49..........PVAAELDLASNDYLG-HPDVLDGGVEAAGGSRLVTGNTELHEAFEHQLASFLGAESA--LVFSSGYTANLGALVALSGPGSLIVSDALSHASLVD--ACRLSRARVVVSPHRD----VDAVDAALAARTE----ERAVVVTE------SVFSADPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEGLAGAPDIVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALR----LDAEPQRARAVLDRAAELATIAGVTEAPVSAVVSVILGDPEIAVGAAAACLDRGVRVVPAGTSRLRLAARASLTDDEMALARQVLTDVLAT.. 395
71 -19.3005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  16  3.............QRIYLDNNATTRIDPKVKEIMDNPSSLHQFGTETHPAIAEALDKLYKGINRDIDDVIITSCATESNNWVLKGVYKGKNHIVTTVAEHPAVRSCNFLESLGVEVTYLINEHGSITAEQVREAITE-------KTALVSVMWNNETGLIFP---IEEIGAICKEKGVLFHTDAVQ---AIGKIPVDVLKAN----ADFLSFSAHKFHGPKGIGGLYIRSGLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRINTTLVSVRGIEGEAMLWDLNRSNIAASTGSHTAIRLSLSRFNTEAEIDKTIEVFSQAAVR.. 379
72 -19.3005usr_A mol:protein length:426 Cysteine desulfurase, mitochondrial  ali model follow..  17  10...PRGSHMLEMLRPLYMDVQATTPLDPRVLDAMLPHSRTHAYGWESEAAMERARQQVASLIGADPREIIFTSGATESNNIAIKGVASRKKHLITTQTEHKCVLDCRSLEAEGFQVTYLVQKSGIIDLKELEAAIQPD-------TSLVSVMTNNEIGVKQP---IAEIGRICSSRKVYFHTDAAQ---AVGKIPLDVNDMK----IDLMSISGHKIYGPKGVGAIYIRRRLQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSDPKHHYPGCINLSFAYVEGESLLMALKDVALSSGSACTSASSSIRFGIGRFTTEEEVDYTVEKCIQHVKR.. 395
73 -19.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  11  57RRRKAHQEKNPDAKIISLGIGDTTEPLPKIADAMAKAAAGLATGYGAEQGQGALREAVASTFYGHAADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHFFPDLSK-AKRTDIIFFCSPNNTGAAATRAQLTELVNFARKNGSILVYDPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEPVHADWNRVMTTCFNGASNIVQAGGLACLQPE--NAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDVFAEILERGSGYGPAGEGFVRA--SAFGSRENILEAVRRFKEAYGKRN 441
74 -19.2001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  14  12IREPATVLGISPDQLLDFSANNPLGMPVSVKRALIDN-LDCIERY-PDADYFHLHQALARHHQVPASW-ILAGNGE-TESIFTVASGLKPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTP-------DLDCLFLCTPNNTGLLPERPLLQAIADRCKSLNINLILDEAFI------IPHETGFIPALKDNPHIWVSLTKFYAIPGGYLVNSDDAAMARMRRQQM-----WSVNALAALAGEVALQDSAWQQATWHWLREEGAFYQALCQLPLLTVYPGRANYLLLRCERE-DIDLQRRLLTQRILIRS-DSRYYRVAIR---SAAQNERLLAALRNVLTGIA 361
75 -19.1004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  13  28........ISDIPDVLKLTLGEPDFATPKIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNDFVLTPEMLEEAILKEGE----ALKAVILNYPTNTGVTYSRQQIKNLAEVLKKYPIFVISD--EVYAELTYTGESVSIAEYLPDQTILISGLSKSHAMTGWRLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVKFLQDFAKEKAVAGVAFGKYGEGYLRI--SYAASMETIKEAMKRLKEFMEQYA 392

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.