current user: public

If you have questions about the server, please let us know.

Query: 1tu9_A mol:protein length:134 hypothetical protein PA3967, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst GHMNAADRVMQSYGRCCASTGFFDDFYRHFLASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDRDCDAETRDAWRDVMGRGIAVIKSYYGSLast
1 -69.6001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model  100  1GHMNAADRVMQSYGRCCASTGFFDDFYRHFLASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGASHSRAALDIRPELYDLWLDALLMAVAEHDRDCDAETRDAWRDVMGRGIAVIKSYYGS 134
2 -47.8003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  14  4...EEIKMIQKSWLRVIDKDEAGLLFYRRLFDVEPKVRPLFK-IDIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSWTKQLEQLWTQAYEALAQVMIEE... 132
3 -47.1003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  17  5...KEKELIKESWKRIEPNNEIGLLFYANLFKEEPTVSVLFQ-NPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQFTEEAKAAWTKVYGIAAQVMTAE... 133
4 -47.0002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  13  4...EQIQIIKDCVPILQKNEDLTNEFYKIMFNDYPEVKPMFNMEKSGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLN-PDEATLKAWEVAYGKIAKFYIDIEKK 136
5 -46.9001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  14  5...QTINIIKATVPVLKEHVTITTTFYKNLFAKHPEVRPLFDRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDATDDILDAWGKAYGVIADVFIQVEAD 139
6 -44.8001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  17  6...KQDALVSSSFEAFKANPQYSVVFYTSILEKAPAAKDLFSNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDWSDELSRAWEVAYDELAAAIKKA... 143
7 -44.1001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  16  5...AQRQVVASTWKDIAGSDGVGKECFTKFLSAHHDMAAVFGDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGMNAAAKDAWAAAYADISGALISGLQS 147
8 -44.0001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  16  5...AQRQVVASTWKDIAGADGVGKECLSKFISAHPEMAAVFGDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGMNAAAKDAWAAAYGDISGALISGLQS 147
9 -43.2001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  16  5...AQRQVIAATWKDIAGADGVGKKCLIKFLSAHPQMAAVFGDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGGMNAAAKDAWAAAYADISGALISGLQS 147
10 -43.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  13  6...SQAALVKSSWEEFNANPKHTHRFFILVLEIAPAAKDLFSNPELQAHAGKVFKLVYEAAIQLEVTGVVVTDLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAWSEELNSAWTIAYDELAIVIKKEMDD 151
11 -43.0001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  12  4...PEPELIRQSWRAVSRSLEHGTVLFARLFALEPDLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPFTPATRAAWSQLYGAVVQAMSRGWDG 150
12 -42.8004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  12  4...PEPELIRQSWRAVSRSLEHGTVLFARLFALEPDLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPFTPATRAAWSQLYGAVVQAMSRGWDG 150
13 -42.3002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  13  7...PESELIRQSWRVVSRSLEHGTVLFARLFALEPSLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPFTPATRTAWSRLYGAVVQAMSRGWDG 153
14 -41.6004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  12  12...EQQSLIMEDVQVLLPNDDFVEDVLQQFMEENPETFQIFPHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEWSEEKKEAWLKAYGIITVMVTE.... 154
15 -40.7003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  12  12...EQEALVVKSWSVMKKNAELGLKLFIKIFEIAPTTKKMFSNPKLKPHAMSVFVMCCESAVQLRKTGKVTVTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEWSPEMKVAWGQAYDHLVAAIKAEMNL 158
16 -39.6001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  13  5...CEKQTIGKIAQVLAKSEAYGAECLARLFVTHPGSKSYFEYKDYSAAGAKVQVVIRAVVKAAEHVDDLHSHLETLALTHGKLLVDPQNFPMLSECIIVTLATHLTEFSPDTHCAVDKLLSAICQELSSRYR. 140
17 -39.5003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  12  13...EQEALVVKAWAVMKKNAELGLQFFLKIFEIAPSAKNLFSNPKLKPHATTVFVMTCESAVQLRKAGKVTVDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEWSPEMKNAWGVAYDQLVAAIKFEMKP 159
18 -39.4001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  11  17...EQEALVLKSWAILKKDANIALRFFLKIFEVAPSASQMFSNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVDMWSPAMKSAWSEAYDHLVAAIKQEMKP 164
19 -39.4003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  13  13...EQEALVVKSWAVMKKNAELGLKFFLKIFEIAPSAKNLFSNPKLKPHAMTVFVMTCESAVQLRKAGKVTVNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEWSPEMKNAWGEAYDQLVAAIKSEMKP 159
20 -39.3003mkb_A mol:protein length:140 Hemoglobin subunit alpha  ali model follow..  13  5...VERSTIGAIAKILASTEAYGAEALARLFATHPGAKSYFDYADYSAAGAKVQKVIRAVVSAAEHDDDLHAHLMVLAVTHGKLLVDPSNFPMLSECILVTLATHLAEFSPATHCAVDKLLSAISSELSSKYR. 140
21 -39.3002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  15  7...PQKAAIRSSWSKFMDNVSNGQGFYMDLFKAHPETLTPFKNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMEDHN-HMVGGAKDAWEVFVGFICKTLGDYMKE 150
22 -39.2002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  13  13...EKEALVLKSWAIMKKDANLGLRFFLKIFEIAPSARQMFPNPKLKTHAVSVFVMTCEAAAQLRKAGKITVTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALPMWGPEMRNAWGEAYDQLVAAIKQEMKP 160
23 -39.2004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  18  3.AEKTRSIIKATVPVLEQQTVITRTFYKNMLTEHTELLNIFNRTNQKAQPNALATTVLAAAKNIDDLSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDATPEIINAWGEAYQAIADIFITVEKK 139
24 -39.1002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  12  16...EQEALVLKSWAVMKKDANLGLRFFLKVFEIAPSAKQMFSNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVTLKRLGATHLRYGVADGHFEVTGFALLETIKEALPMWSLEMKKAWAEAYSQLVAAIKREMKP 163
25 -38.7004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  16  16...DQKDLLRMSWGVLSVDEGTGLMLMANLFKTSPSAKGKFANSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNFDEDTVAAWASLVAVVQAAL...... 152
26 -38.6001gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  14  6...EERDEISKTFQGT-DMKTVVTQALDRMFKVYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADLHVDPGSFHLLTDCIIVELAYLRKDFTPHIQGIWDKFFEVVIDAISKQY.. 135
27 -38.5003a0g_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  12  5...ADKNNVKTTWDKIGGHAEYVAEGLTRMFTSFPTTKTYFHSGDIKAHGKKVADALTTAVGHLDDLPTALSTLSDVHAHK--LRVDPVNFKFLNHCLLVTLAAHLGAFTPSIHASLDKFFASVSTVLTSKYR. 141
28 -38.5003mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  17  6...EERDEIVKTFFSA-NSSAIGTKALERMFVVFPWTNAYFAKXXXFSASIHAAIVVGALQDAVKHEDDVKAEFVNISKAHAKLHIDPGSFHLLTDSFIVELAHLKKVFTPFVFAVWIKFFQVVIDAISSQYH. 136
29 -38.3003d1a_A mol:protein length:142 Hemoglobin subunit alpha-1/2  ali model follow..  13  6...ADKSNVKAAWGKVGGNGAYGAEALERMFLSFPTTKTYFPSAQVKGHGEKVAAALTKAVGHLDDLPGTLSDLSDLHAHK--LRVDPVNFKLLSHSLLVTLACHLPNFTPAVHASLDKFLANVSTVLTSKYR. 142
30 -38.2004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  12  14...AIKANLRRSWGVLSADEATGLMLMSNLFTLRPDTKTYFTNSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYSDDVAGAWAALVGVVQAAL...... 150
31 -38.2001xz7_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  14  5...ADKTNVKAAWGKVGAHGEYGAEALERMFLSFPTTKTYFPSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD--LHAHKLAVDPVNFKLLSHCLLVTLAAHLPAFTPAVHASLDKFLASVSTVLTSKYR. 141
32 -38.0001hbr_A mol:protein length:141 PROTEIN (HEMOGLOBIN D)  ali model follow..  13  5...EDKKLIQQAWEKAASHEEFGAEALTRMFTTYPQTKTYFPSDQVRGHGKKVLGALGNAVKNVDNLSQAMAELSNLHAYN--LRVDPVNFKLLSQCIQVVLAVHMGKYTPEVHAAFDKFLSAVSAVLAEKYR. 141
33 -37.9001jeb_A mol:protein length:142 HEMOGLOBIN ZETA CHAIN  ali model follow..  14  6...TERTIIVSMWAKISTQDTIGTETLERLFLSHPQTKTYFPSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYI--LRVDPVNFKLLSHCLLVTLAARFPAFTAEAHAAWDKFLSVVSSVLTEKYR. 142
34 -37.7001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  16  16...AEKDLIRSTWDQLMTHTGFVADVFIRIFHNDPTAQRKFPSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVFTKQVHDAWAKTFAIVQGVLITKHAS 159
35 -37.7001v75_A mol:protein length:141 Hemoglobin D alpha chain  ali model follow..  10  5...DDKQLIQHVWEKVLEHEDFGAEALERMFIVYPSTKTYFPHFDIRHHGKKVVGALGDAVKHIDNLSATLSELSNLHAYN--LRVDPVNFKLLSHCFQVVLGAHLGRYTPQVQVAYDKFLAAVSAVLAEKYR. 141
36 -37.6003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  16  7...PQKAALKSSWSRFMNNVTNGTNFYMDLFKAYPDTLTPFKHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCH-VEGSTKNAWEDFIAYICRVQGDFMKE 150
37 -37.6001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  14  6...AEADLAGKSWAPVFANNANGLDFLVALFEKFPDSANFFASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA-PPAGADAAWTKLFGLIIDALKAAGA. 147
38 -37.6001cqx_A mol:protein length:403 FLAVOHEMOPROTEIN  ali model follow..  15  3.TQKTKDIVKATAPVLAEHYDIIKCFYQRMFEAHPELKNVFNMAHQEQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNATDDIISAWAQAYGNLADVLMGMESE 139
39 -37.6003a59_A mol:protein length:141 Hemoglobin subunit alpha-A  ali model follow..  13  5...TDKTNVKGIFSKISSHEEYGAETLERMFITYPQTKTYFPSAQIKAHGKKVANALIEAVNHIDDISGALSKLSDLHAQK--LRVDPVNFKLLGQCFLVVVAIHHPSLTPEVHASLDKFLCAVGAVLTAKYR. 141
40 -37.5001xzv_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  13  5...ADKTNVKAAWGKVGAHGEYGAEALERMFLSFPTTKTYFPSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK--LRVDAVNFKLLSHCLLVTLAAHLPAFTPAVHASLDKFLASVSTVLTSKYR. 141
41 -37.5002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  14  5...LEQILVKTQWAQSYGEAEFSRDLFSELFNIQGSSRALFSSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTH---LDCFNQHAWGECYERIASGISG.... 140
42 -37.5001iwh_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  11  5...ADKTNVKAAWSKVGGHGEYGAEALERMFLGFPTTKTYFPSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHK--LRVDPVNFKLLSHCLLSTLAVHLPNFTPAVHASLDKFLSSVSTVLTSKYR. 141
43 -37.4003at5_B mol:protein length:146 Beta-globin  ali model follow..  13  6...EERQFIVNLWGRV-DVEQIGAEALARLLIVYPWTQRFFSNAKVHAHGKKVLTSFGEAVKNLDQIKQTFAQLSE--LHSDKLHVDPENFKLLGNILIIVLAAHFGKFTPASQAAWQKLVSAVAHALALRYH. 146
44 -37.4003ia3_B mol:protein length:145 Hemoglobin subunit alpha  ali model follow..  14  9...ADKTNVKAAWGKVGAHGEYGAEALERMFLSFPTTKTYFPSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK--LRVDPVNFKLLSHCLLVTLAAHLPAFTPAVHASLDKFLASVSTVLTSKYR. 145
45 -37.4002zfb_B mol:protein length:146 Hemoglobin subunit beta  ali model follow..  13  6...EEKQLITGLWGKV-NVAECGAEALARLLIVYPWTQRFFTNPNVRAHGKKVLTSFGEAVKNLDNIKNTFAQLSEL--HCDKLHVDPENFRLLGDILIIVLAGHFGKFTPDCQAAWQKLVRAVAHALARKYH. 146
46 -37.4001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  14  5...AEADLAGKSWAPVFANNANGDAFLVALFEKFPDSANFFASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA-PPAGADAAWTKLFGLIIDALKAAGK. 146
47 -37.3001y09_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  14  5...ADKTNVKAAWGKVGAHGEYGAEALERMFLSFPTTKTYFPSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDL--HAHKLRVDPVAFKLLSHCLLVTLAAHLPAFTPAVHASLDKFLASVSTVLTSKYR. 141
48 -37.3001xzu_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  14  5...ADKTNVKAAWGKVGAHGEYGAEALERMFLSFPTTKTYFPSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK--LRVGPVNFKLLSHCLLVTLAAHLPAFTPAVHASLDKFLASVSTVLTSKYR. 141
49 -37.2004yu3_A mol:protein length:141 hemoglobin  ali model follow..  12  5...ADKTNIKASWEKIGSHGEYGAEALERTFLCFPTTKTYFPSAQVKAHGKKVADALTNAVGHLDDLPGALSALSDL--HAYKLRVDPVNFKLLSHCLLVTLASHHPAFTPAVHASLDKFLSSVSTVLTSKYR. 141
50 -37.2003vre_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  12  5...NDKTNVKATWSKVGDHSDYVAEALERMFFSFPTTKTYFPSGQVKGHGKKVGEALTQAVGHLDDLPSALSALSDLHAHK--LRVDPVNFKLLSHCLLVTLSSHQPTFTPEVHASLDKFLSNVSTVLTSKYR. 141
51 -37.2002rao_A mol:protein length:141 Hemoglobin subunit alpha-1/2  ali model follow..  10  5...ADKTNIKTAWEKIGSHGEYGAEAVERMFLGFPTTKTYFPSEQIKAHGKKVSEALTKAVGHLDDLPGALSTLSDLHAHK--LRVDPVNFKLLSHCLLVTLANHHPSFTPAVHASLDKFLANVSTVLTSKYR. 141
52 -37.1002b7h_B mol:protein length:146 hemoglobin beta chain  ali model follow..  11  6...EEKSLVSGLWAKV-NVDEVGGEALGRLLIVYPWTQRFFDNAKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSE--LHCDKLHVDPENFKLLGNVLVCVLAHHFGKFTPQVQAAYQKVVAGVANALAHKYH. 146
53 -37.1001s0h_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  12  5...ADKTNVKAAWSKVGGNGEFGAEALERMFLGFPTTKTYFPSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHK--LRVDPVNFKLLSHCLLSTLAVHLPNFTPAVHASLDKFLSSVSTVLTSKYR. 141
54 -37.1001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  15  3.DAQTIATVKATIPLLVETPKLTAHFYDRMFTHNPELKEIFNMSNQRNQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFS-PGQEVLDAWGKAYGVLANVFINREAE 137
55 -37.1002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  13  5...ADKTNVKAAWSKVGGHGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKKVADGLTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNFTPAVHASLDKFLSSVSTVLTSKYR. 141
56 -37.1004yu3_B mol:protein length:146 hemoglobin  ali model follow..  11  6...EEKAHVSGLWGKV-NTEEVGGEALGRLLVVYPWTQRFFENPKVKAHGKKVLSSFSDGLKNLDNLKGTFAALSELHCDK--LHVDPENFKLLGNVLVCVLAHHFGKFTPQVQAAYQKIVAGVANALAHKYH. 146
57 -37.0001y0a_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  13  5...ADKTNVKAAWGKVGAHGEYGAEALERMFLSFPTTKTYFPSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK--LRVDPVNFKLLSHCLLVTLAAHLPAFTPAVHASLDKFLASVSTVLTSKAR. 141
58 -36.9003a59_B mol:protein length:146 Hemoglobin subunit beta  ali model follow..  14  6...EEKQLISGLWGKV-NVADCGAEALARLLIVYPWTQRFFANPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSEL--HCDKLHVDPENFRLLGDILIIVLAAHFTKFTPECQAAWQKLVRVVAHALARKYH. 146
59 -36.9002qmb_B mol:protein length:146 Hemoglobin beta chain  ali model follow..  14  6...EEKQLITGLWGKV-NVADCGAEALARLLIVYPWTQRFFANPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSE--LHCDKLHVDPENFRLLGDILIIVLAAHFSKFTPECQAAWQKLVRVVAHALARKYH. 146
60 -36.9001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  17  16...AQKKIVRKTWHQLMRNTSFVTDVFIRIFAYDPSAQNKFPSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSFNEKTRDAWAKAFSVVQAVLLVKHG. 158
61 -36.9001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  15  7...LQRLKVKRQWAEAYGSGNFGHFIWSHVFQHSPAARDMFKTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFD-QDAWKPCLNVITNGIQG.... 144
62 -36.8003d4x_B mol:protein length:145 Hemoglobin subunit beta-A/B  ali model follow..  12  5...EEKGLVNGLWGKV-NVDEVGGEALGRLLVVYPWTQRFFENAKVKAHGKKVLNSFSDGLKNIDDLKGAFAKLSE--LHCDKLHVDPENFRLLGNVLVCVLAHHFGHFNPQVQAAFQKVVAGVANALAHKYH. 145
63 -36.8001fhj_A mol:protein length:141 HEMOGLOBIN (ALPHA CHAIN)  ali model follow..  11  5...ADKTNIKSTWDKIGGHGDYGGEALDRTFQSFPTTKTYFPSAQVKAHGKKVADALTTAVAHLDDLPGALSALSD--LHAYKLRVDPVNFKLLSHCLLVTLACHHPTFTPAVHASLDKFFTAVSTVLTSKYR. 141
64 -36.8002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  11  4...DEVQLIKKTWEIPVATTDSGAAILTQFFNRFPSNLEKFPNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAAS-SLDESQAATWAKLVDHVYAIIFKAIDD 148
65 -36.8001fsx_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  13  5...ADKGNVKAAWGKVGGHAEYGAEALERMFLSFPTTKTYFPSAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDL--HAHKLRVDPVNFKLLSHSLLVTLASHLPSFTPAVHASLDKFLANVSTVLTSKYR. 141
66 -36.7001fdh_G mol:protein length:147 HEMOGLOBIN F (DEOXY) (GAMMA CHAIN)  ali model follow..  12  7...EDKATITSLWGKV-NVEDAGGETLGRLLVVYPWTQRFFDNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSE--LHCDKLHVDPENFKLLGNVLVTVLAIHFGKFTPEVQASWQKMVTGVASALSSRYH. 147
67 -36.7003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  15  6...LQRLKVKRQWAEAYGSGNFGHFIWANVFKVAPSARDMFKTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQ-NVFDKDAWQACLDVITSGIQGN... 144
68 -36.7001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  6...DQEHYIKGVWKDV-DHKQITAKALERVFVVYPWTTRLFSKANDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKFRPKEHAAAYKFFRLVAEALSSNY.. 140
69 -36.6004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  17  6...LTRLKVKAQWRRAYSHGDFAQAIWRALFAQVPDSRTLFKSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRWDKD---AWSACFDHIAHGIKG.... 142
70 -36.6001hbr_B mol:protein length:146 PROTEIN (HEMOGLOBIN D)  ali model follow..  14  6...EEKQLITGLWGKV-NVAECGAEALARLLIVYPWTQRFFANPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSELHCDK--LHVDPENFRLLGDILIIVLAAHFSKFTPECQAAWQKLVRVVAHALARKYH. 146
71 -36.6001bab_A mol:protein length:143 HEMOGLOBIN THIONVILLE (DEOXY) (ALPHA CHAIN)  ali model follow..  14  7...ADKTNVKAAWGKVGAHGEYGAEALERMFLSFPTTKTYFPSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK--LRVDPVNFKLLSHCLLVTLAAHLPAFTPAVHASLDKFLASVSTVLTSKYR. 143
72 -36.6003wtg_A mol:protein length:142 Hemoglobin subunit alpha-A  ali model follow..  12  6...ADKTNTKSVFAKIGPHEEYGAETLERLFTTYPQTKTYFPSAQVKAHGKKVAAALVEAANHIDDISTALSKLSDL--HAQKLRVDPVNFKLLGQCFLVVVAIHHPSLTPEVHASLDKFLCAVANVLTAKYR. 142
73 -36.5003cy5_B mol:protein length:145 Hemoglobin subunit beta  ali model follow..  12  5...EEKAAVTAFWGKV-HVDEVGGEALGRLLVVYPWTQRFFENPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDK--LHVDPENFKLLGNVLVVVLARHFGKFTPVLQADFQKVVAGVANALAHRYH. 145
74 -36.5001a9w_E mol:protein length:146 HEMOGLOBIN (BETA CHAIN)  ali model follow..  11  6...EEKAAVTSLWSKM-NVEEAGGEALGRLLVVYPWTQRFFDNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSE--LHCDKLHVDPENFKLLGNVMVIILATHFGKFTPEVQAAWQKLVSAVAIALAHKYH. 146
75 -36.5001qpw_A mol:protein length:141 PORCINE HEMOGLOBIN (ALPHA SUBUNIT)  ali model follow..  13  5...ADKANVKAAWGKVGGQGAHGAEALERMFLGFPTTKTYFPSDQVKAHGQKVADALTKAVGHLDDLPGALSALSDLHAHK--LRVDPVNFKLLSHCLLVTLAAHHPDFNPSVHASLDKFLANVSTVLTSKYR. 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.