current user: public

If you have questions about the server, please let us know.

Query: 1ux8_A mol:protein length:132 YJBI PROTEIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRSSLast
1 -72.8001ux8_A mol:protein length:132 YJBI PROTEIN  ali model  100  1MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRSS 132
2 -63.4002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  65  1..EQWQTLYEAIGGETVAKLVEAFYRRVAAHPDLRPIFPDDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHLD... 128
3 -62.7005v3t_A mol:protein length:132 Globin  ali model follow..  66  1MSKQPMTPFEAIGGQCIEILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGE.. 131
4 -61.0002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  38  1MSSETVTLYEAIGGATVRALTRRFYELMDTLPEAARCRAADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNP... 133
5 -60.5005d1v_A mol:protein length:127 Globin  ali model follow..  39  2...SEPTIYEQIGGATFRRIVDIFYARVEADPRLRHLFPADLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGED.... 127
6 -58.5004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  34  18.PTPEKTPYEILGGAGALAIANRFYDIMATDEYAKPLYDMPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQ........ 144
7 -57.4002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  41  2......TFYEAVGGETFTRLARRFYEGVAADPVLRPMYPEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE...... 123
8 -54.2004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  37  30.HDDQMTFYEAVGGETFTRLARRFFEGVAADPVLRPMFPEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDAQPP. 161
9 -53.9001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  38  2....PKSFYDAVGGKTFDAIVSRFYAQVAEDEVLRRVYPEDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP....... 127
10 -52.5004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  28  20FAIDESNLFDKLGLQTFINLSTNFYTRVYDDEEEWFQSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAGNELKNQNE 155
11 -52.1004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  20  4.TAPADSLYSRMGGAAVEKAVDVFYERIVADPQLAPFFANDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAGAAN. 135
12 -50.7002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  21  9.KREPISIYDKIGGEAIEVVVEDFFVRVLADDQLSAFFSGNMSRLKGKVVEFFAAALGGPEPYT----GAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTT.... 133
13 -50.7001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  23  9.KREPISIYDKIGGEAIEVVVEDFYVRVLADDQLSAFFSGNMSRLKGKQVEFFAAALGGPEPYT----GAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTA... 134
14 -50.3003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  23  1MNKP-QTIYEKLGGNAMKAAVPLFYKKVLADERVKHFFKNDMDHQTKQQTDFLTMLLGGPNHYK----GKNMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK........ 121
15 -50.0006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  17  1.....STLHAKLGGAAVAATVDVFYKKLMNDPDLEPFFRGDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKGKVD. 128
16 -48.5001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  19  1......SLFEQLGGAAVQAVTAQFYANIQADATVATFFNGDMPNQTNKTAAFLCAALGGPNAWT----GRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT......... 115
17 -48.4002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  15  1.....ASLYEKLGGAAVDLAVEKFYGKVLADERVNRFFVNDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHDVLNR........ 123
18 -48.2004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  23  47.VKFPSKKVYLAAGELLRKLVEVHHENLMKSKIHYLFPHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRTTLEPPR 180
19 -47.9001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  24  1....MSTLYEKLGGTAVDLAVDKFYERVLQDDRIKHFFADDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPARDVLNQ........ 124
20 -47.4001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  18  39.RKCPSSLFAKLGGEAVEAAVDKFYNKIVADPTVSTYFSNDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ..... 164
21 -43.7002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  23  4.........ETINQESIAKLMEIFYEKVRKDKDLGPIFNNEWKEHKAKIGNFWAGMLLGE----GDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIV-YNEEMKNVILQRAQMIASHFQNMLYKYGG.. 126
22 -14.9004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  10  16VEQADPPIRAKAAVAHAHYLSIEFYRIVRIDPHAEEFLSNEERQLKSAMERWIINVLSAQVDDVERLIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSID......... 145
23 -14.7003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  14  1MTREEIKMIQKS-IDKMDEAGLLFYRRLDVEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDA----RELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE........ 132
24 -14.7001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  15  20.................TGFFDDFYRHFASSPQIRAKFATDMTAQKHLLRAGIMNLVMYARGMSDSK---GASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYGS..... 134
25 -14.7002w31_A mol:protein length:162 GLOBIN  ali model follow..  13  29.............ETNKERLADQFYDYLLGIPETAEFLKEDLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI............... 138
26 -14.4001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  13  59.............QENIVNIVDAFYKNLDHESSLMDIINDHVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI............... 168
27 -14.4003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  15  2IDQKEKELIKES-EPNKNEIGLLFYANLKEEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNLEG----QDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE........ 133
28 -14.3004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  10  11VEQADPPIRAKAAEAHAHYLSIEFYRIVRIDPHAEEFLSNEERQLKSAMERWIINVLSAQVDDVERLIQHTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS............... 138
29 -13.9002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  11  1MTKEQIQIIKDC-QKNGEDLTNEFYKIMNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIEN----DKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK. 140
30 -13.1005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  12  34.............APHFPRLAEEFYDRILGHEGARTALVGGVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV............... 145
31 -12.9001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  14  2LDQQTINIIKAT-KEHGVTITTTFYKNLAKHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIEN----KKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVEADLYAQA 144
32 -12.8004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  13  58LGQFPAPVVAQIRTTHQSELPGYFYEQMLQDEQAMLFLTHEKSRLHGTLRQWIVSVFSMSDAALQALQQKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET............... 187
33 -12.7004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  14  32.............TANKAALADYFYESMLADPNAAFFLSDQKTKLHASMQDWLESVYAAA--PTEEYFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV............... 145
34 -12.1002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  16  34FTAEDEEYIQKAGEDQVEEILDTWYGFVGSHPHLLYYFEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA............... 177
35 -11.9001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  13  3FTEKQDALVSSS-KANIPQYSVVFYTSIEKAPAAKDLFSPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK......... 142
36 -10.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  11  3LTESQAALVKSS-NANIPKHTHRFFILVEIAPAAKDLFSPELQAHAGKVFKLVYEAAIQLEVTGVV---KNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMDDAA... 153
37 -10.1004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  14  2LAEKTRSIIKAT-EQQGTVITRTFYKNMTEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDD----KQIGHKHRALQIKPEHYPIVGEYLLKAIKEVAATPEIINAWGEAYQAIADIFITVEKKMYEEA 144
38 -9.9201eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  12  1LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTAPFETHANRIVGFFSKIIGELPNIEADV--NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK........ 135
39 -9.9101gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  15  2LDAQTIATVKAT-VETGPKLTAHFYDRMTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIEN----EKIAQKHTSFQIKPEQYNIVGEHLLATLDEFSPGQEVLDAWGKAYGVLANVFINREAEIYNEN 142
40 -9.7903qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  10  10FTEEQEALVVKS-KKNSAELGLKFFLKIEIAPSAKNLFSYEQNPKLKPHAMTVFVMTCESAVQLRKAGKKRLGAIHFKNGVVNEHFEVTRFALLETIKEAMWSPEMKNAWGEAYDQLVAAIKSEMKPSST.. 162
41 -9.7801d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  14FSEEQEALVLKS-KKDSANIALRFFLKIEVAPSASQMFSFEKNPKLKTHAMSVFVMTCEAAAQLRKAGKKRLGATHLKYGVGDAHFEALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE... 166
42 -9.6502r4x_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKDKLRGVSITLMYALQNFIDQLDNPDDLVC-EKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
43 -9.6102bk9_A mol:protein length:153 CG9734-PA  ali model follow..  1MNSDEVQLWEIPVATPTDSGAAILTQFFNRFPSNLEKFP-SGNARFRAHAGRIIRVFDESIQVLGQDGDTKIAVSHIPRTVSKESYNQLKGVILDVLTASSLDESQAATWAKLVDHVYAIIFKAIDDDGNAK 153
44 -9.5401oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  10  1MERPEPELIRQS-SRSPLEHGTVLFARLALEPDLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKSAFTPATRAAWSQLYGAVVQAMSRGWDGE.... 151
45 -9.5203uhb_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNFIDQLDNPD-EKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
46 -9.5204mpm_A mol:protein length:151 Neuroglobin  ali model follow..  10  1MERPEPELIRQS-SRSPLEHGTVLFARLALEPDLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCAFTPATRAAWSQLYGAVVQAMSRGWDGE.... 151
47 -9.5203uhc_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQAFIDQLDNPD-EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
48 -9.4903zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  9FTEEQEALVVKS-KKNSAELGLKLFIKIEIAPTTKKMFSFEQNPKLKPHAMSVFVMCCESAVQLRKTGKKRLGASHSKYGVVDEHFEVAKYALLETIKEAMWSPEMKVAWGQAYDHLVAAIKAEMNLSN... 160
49 -9.4903uhd_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNFIDQLDNPD-EKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
50 -9.4602r4z_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVWGSDKKGNGVALMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNFIDQLDNPDDEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
51 -9.4602auo_A mol:protein length:146 Globin I  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDDLVC-EKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
52 -9.4603ugy_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNYIDQLDNPD-EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
53 -9.4503ugz_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVAAMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNFIDQLDNPD-EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
54 -9.4401hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNFIDQLDNPD-EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
55 -9.4302oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  13  10FSEEKEALVLKS-KKDSANLGLRFFLKIEIAPSARQMFPPKLKTHAVSVFVMTCEAAAQLRKAGK----KRLGGTHLKYGVADGHFEALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE... 162
56 -9.4002grf_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALVTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNFIDQLDNPD-EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
57 -9.3903uhi_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKR--NDKLRGHSITLMYALQNFIDQLDNPD-ERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
58 -9.3703uh6_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDWKVIGSDKKGNGVALMTTLFADNQETIGYFKDKLRGHSIALMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........... 146
59 -9.3602r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  14  13FGEEQEALVLKS-KKDAANLGLRFFLKVEIAPSAKQMFSPKLKTHAMSVFVMTCEAAAQLRKAGK----KRLGATHLRYGVADGHFEALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPDA... 165
60 -9.2603pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  4LTGPQKAAWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSLFHPTMKAQSLVFCNGMSSFVDNLDDHE-QKMAKLHFNRGIRIKELRDGYGVLLRYLEDCHVEGSTKNAWEDFIAYICRVQGDFMKER.... 151
61 -9.2401hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  10  13LTPAEKDLWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEGFTKQVHDAWAKTFAIVQGVLITKHAS..... 159
62 -9.2202vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  10  4MERPESELIRQS-SRSPLEHGTVLFARLALEPSLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----TSLGRKHRAVGVRLSSFSTVGESLLYMLEKSDFTPATRTAWSRLYGAVVQAMSRGWDGE.... 154
63 -9.2201jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  10  2LSAAQRQVVASTGADNGAGVGKECLSKFSAHPEMAAVFGPGVAELGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQS..... 147
64 -9.0902c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  1MNSEEVNDWEVVAAKMTEAGVEMLKRYFKKYPHNLNHFPW--NARFKTHGTRILRQVDEGVKALSVDFGKKLAQTHHEKKVERRSYNELKDIIIEVVCSVKLNEKQVHAYHKFFDRAYDIAFAEMAK..... 149

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.