current user: public

If you have questions about the server, please let us know.

Query: 1v2d_A mol:protein length:381 Glutamine Aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380
# Score Template Links and tools%idFirst MRLHPRTEAAKESIFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPGWDAFRLVEEARVALIPASAFYLEDPPKDLFRFAFCKTEEELHLALERLGRVVNSPREAEGGAVSGLast
1 -119.0001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model  100  1MRLHPRTEAAKESIFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPGWDAFRLVEEARVALIPASAFYLEDPPKDLFRFAFCKTEEELHLALERLGRVVNSPREAEGGAVSG 381
2 -103.0001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  32  13FDLPKRYQGSTKSVWVEYIQLAAQYKPLNLGQGFPDYHAPKYALNALAAAANSANQYTRGFGHPRLVQALSKLYSQLMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIRICTLMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETESPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSRFTKWMTKSVGLQGIPPSAFYSEPNGEDFVRYCFFKKDENLQKAAEILRKWKGS........... 428
3 -103.0004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  35  5.LQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGLNQYTKTFGYPPLTKILASFFGELLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHISIASLMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDRFVKWMIKNKGLVAIPVSIFYSVPHFDHYIRFCFVKDEATLQAMDEKLRKWKVELENLYFQGKGG 432
4 -103.0003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  34  28YFTSNTAKDVWSLTNEAAAKAAQGRELINLGQGFFSYSPPQFAIKEAQKALPMVNQYSPTRGRPSLINSLIKLYSLKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKRISHWLINELGVVAIPPTEFYIKEHAENLLRFAVCKDDAYLENAVERLKLLKDYL.......... 447
5 -103.0001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  35  6LIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVQGANQYAPMTGVQALREAIAQKTERLDSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMAL--QPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQGHASVLAHLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLR--AEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAEFCQWLTQEHGVAAIPLSVFCADPFPHKLIRLCFAKKESTLLAAAERLRQL.............. 386
6 -102.0005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  34  1.ANAKRIEGLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAADNMNQYTRGFGHPALVKALSCLYGKINEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGTHVKIATLMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSKFVKWMTKHKKLTAIPVSAFCDSKSFEKLVRFCFIKKDSTLDAAEEIFRAW.............. 410
7 -102.0002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  41  1MATVSRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIGGVNQYPPGPGSAPLRRAIAAQRRRHETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHRHLPLAGFMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALD--TEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPEFCAALPEKVGVAAIPMSAFCDPAAGNHLVRFTFCKRDDTLDEAIRRLSVLAERPATGVP..... 401
8 -99.5001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  32  1MALSDRLELVSASEIRKLFDIAAGKDVISLGIGEPDFDTPQHIKEYAKEALKGLTHYGPNIGLLELREAIAEKLKKQKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTY-EEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDRHYSIASLMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDKFSELMLKEARVAVVPGSAFG--KAGEGYVRISYATAYEKLEEAMDRMERVLKERK......... 387
9 -98.9001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  40  3.GLSRRVQAMKPSATVAVNAKAQGVDLVALTAGEPDFDTPEHVKEAARRALQGKTKYAPPAGIPELREALAEKFRVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETL-PEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEARAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPRAAERLL-EAGVAVVPGTDFA----AFGHVRLSYATSEENLRKALERFARVLGR........... 384
10 -96.9004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  27  8.RFNKNLNKIEVSMIRQFDQSSDIPDVLKLTLGEPDFATPKHIKEAAKRAIADESHYTGMAGLLALRQAASAFVKEKDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT--RSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGSHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALT--NGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVKFLQDFAKEKAVAFIPGVAFG--KYGEGYLRISYAASMETIKEAMKRLKEFMEQYAD........ 393
11 -95.3001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  30  6IMVSRRISEIPISKTMELDAKAKGEDVINLTAGEPDFPTPEPVVEEAVRFLKGEVKYTDPRGIYELREGIAKRIGISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETF-MSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDN-----SYMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRGKFCERLLEEKKVALVPGSAFL----KPGFVRLSFATSIERLTEALDRIEDFLNS........... 382
12 -94.7002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  27  9.VFSDRVLLTEESPIRKLVPFARGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR-MEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLN--LDDSFFDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELAEEFARWMLTDFNTMVAPLRGFYLTPGGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSSRIS.... 402
13 -94.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  25  2..LSKRLLNFESFEVMDILALAEGKKVIHLEIGEPDFNTPKPIVDEGIKSLEGKTHYTDSRGILELREKISELYDIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF---------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFNLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFE-KETEREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGEEFAYKLLKEKFVALTPGIGFGSK--GKNYIRISYANSYENIKEGLERIKEFLNK........... 370
14 -93.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  22  7.KFKKLGTDNAPGQEVRQSAAGLEARPVDFSHGDVDAPTPGAFDLFSAGVQSGVQAYTEYRGDLGIRDLLAPRLAAFRDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFD--EAPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPKEFVKILRLQAGVVVTPGTEFS--PHTADSVRLNFSQDHEAAVAAARRIVTLVERYRA........ 407
15 -92.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  20  14HMISNKLANIPDSYFGKTMGRKGPLPLINMAVGIPDGPTPQGIIDHFQKALTINQKYGAFHGKEAFKQAIVDFYQRQEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL--EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALN--HYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPQFEQFLVQEKSILVAPGKPFG--ENGNRYVRISLALDDQKLDEAAIRLTELAYLYE......... 398
16 -92.3001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  26  1MKLAARVESVSPSMTLIIDAKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALQGKTRYGPAAGEPRLREAIAQKLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTT-VETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHAASPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYE--NSQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAKDFCSELLDQHQVATVPGAAFG----ADDCIRLSYATDLDTIKRGMERLEKFLHGI.......... 387
17 -92.1003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  22  3.LKNSSRSAVDPFIVMDVMEAAAGRRIIHMEVGQPGTGAPRGAVEALAKSLTDALGYTVALGLPALRQRIARLYDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTA-PENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALE-LTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALD---CDAELQANLDVYKANRKLMLERLPKAFTRIAPPDGAFYVYADVSDAFAAEILEKAGVAVTPGLDFDPER-GAGTLRFSYARATADIEEGLDRLEAFMQARGE........ 384
18 -91.6001xi9_A mol:protein length:406 putative transaminase  ali model follow..  24  4IRASKRALSV-EYAIRDVVLPAKGIKVIRLNIGDPDFQPPEHMKEAYCKAIEGHNYYGDSEGLPELRKAIVEREKITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTI-EEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLTKVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLT--GPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIDKEFVLDVLHNAHVLFVHGSGFG--EYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLKE....... 400
19 -89.9004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  23  24IEKSSKLENVCYDIRGPVLKEAEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCD-ESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDEHHSIAPLAPDLTITFNGLSKTYRVAGFRQGWMVLNGPKKHEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDAKMVLDFLLQEKVLLVQGTAFN--WPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ........ 424
20 -89.7005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  25  3.DRVALRAGVPPFYVMDVWLAATHGDLVNLSAGQPSAGAPEPVRAAAAAALLNQLGYSVALGIPELRDAIAADYTVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCG-PQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFT-PEATAEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDAFCSKLLADTGVAIAPGIDFDTAR-GGSFVRISFAGPSGDIEEALRRIGSWLPS........... 387
21 -89.0005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  28  70MSLSPRVQSLKPSKTMVITDLASGVPVIRLAAGEPDFDTPKVVAEAGINAIEGFTRYTLNAGITELREAICRKLKYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTK-ISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPTHTSFASLMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGLGAGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSASLALYFLDKFQVAMVPGDAFG----DDSCIRISYATSLDVLQAAVEKIRKALEPLRATVS..... 474
22 -88.5003ele_A mol:protein length:398 Amino Transferase  ali model follow..  21  2MVVNESMYQLVRSAIRELFEYGKKENVYDFSIGNPSIPAPQIVNDTIKELVTALHGYTSAQGDVETRAAIAEFLNFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPAD--TEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGA-------TGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKALEDDSNAFCEEEDVLIVAADGFG----CPGWVRISYCVDREMIKHSMPAFEKIYKKYNK........ 398
23 -87.1002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  24  8ARRFARIDRLPPYVFNITAELKRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQRTHGYSTSRGIPRLRRAISHWYRDRESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLV-PGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGKAPSIMQVAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALE--GDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEEFAKKLLQDAKVSVSPGIGFG--DYGDDHVRFALIENRDRLRQAVRGIKAMFRADGLLSPQRKV. 407
24 -85.7002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  27  3.......RVPEPSVFLVVDEAKRGVGLIDLSIGSTDLPPPEAPLKALAEALNDTYGYCLKSCTLPFLEEAARWYEGRRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL---REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALK--TPKEVVRGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPEEFGLRLV-ERGVALAPGRGFG--PGGKGFVRIALVRPLEELLEAAKRIREALD............ 376
25 -85.4003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  18  37VQRNENFGKLRAGYLKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAEGYSGYGAEQGQGALREAVASTFGRAADEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTG-FDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQ-PEGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGDVFAEILERCNIVTTPGSGYG--PAGEGFVRASAFGSRENILEAVRRFKEAYGKRNAS....... 443
26 -85.0003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  21  2.......MTFEPYPFERLRALTPKKRGLDLGIGEPQFETPKFIQDALKNHTHSLNIYPKSAFEESLRAAQRGFFKLKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLT-KENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEAAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWL---DDRHAEFFRNIYANNLKLARKIFKNT----LIYPYSFYVYLPVQNNFAKTLYQNEGIITLPALYLGRNRIGADYVRLALVYDTPLLEKPLEIIETYRENHA......... 376
27 -84.9002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  18  24VSRNSNMSKLQAGYLFPEIARYPDAQVISLGIGDTTEPIPEVITSAMAKKAEGYSGYGAEQGAKPLRAAIAKTFGIGDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIE-NGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLT-PEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNDVFAEILEKTHVVTTPGSGFG--PGGEGFVRVSAFGHRENILEACRRFKQLYK............ 426
28 -84.8001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  20  7..SMSNHAGLVFNPIRTVSDNAKPKPIIKLSVGDPTLDKNLLTSAAQIKKLKECNGYFPTVGSPEAREAVATWWRIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCR-PENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKFTSVADFETVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLN--TPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDVEFFEKLLEEENVQVLPGTIFH----APGFTRLTTTRPVEVYREAVERIKAFCQRHAA........ 415
29 -84.4003jtx_A mol:protein length:396 aminotransferase  ali model follow..  21  1.GMNTLLKQLKPYPFARLHEAMQGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRDNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC--PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWD---DEQHVIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPDAFARNLWQKAAIQVLPGRFLARDNPGEGYVRIALVADVATCVKAAEDIVSLYR............ 396
30 -83.8004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  22  38LVRNVNLEKLKNNYLLEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAEGYRGYGLEQGNKTLRKAIAETFHVKSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKT-KKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLS-SGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGDVFNEILENTHIITVPGSGFG--PGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTKHFTYLSS. 451
31 -82.3006DK6 Entity 1(prereleased)  ali follow..  19  8.FLKLKAGYLFPEIARRVKAFTAAQRLIRCGIGDVTEALPEAVRYAMHEAVDTFKGYGPEQGYDFLRNAIADNDPIEADEIFISDGSKCDTGN-ILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGKCTPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKRRHSTKFNGASYIVQKGAEALYT-DEGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAQMFDKMLNEANVVITPGSGFG--SAGEGYFRISAFNSRANVEEVCRRIAAL.............. 410
32 -81.0003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  24  1MKRNPHFVSLTKNYLAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIATCRGYGPDFGLPALRQKLSEDFYVDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENAFFPEFPE-----DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ----LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQDLFDFFLREYHIAITPGIGFG--RSGSGFVRFSSLGKREDILAACERLQMAPALQS......... 394
33 -80.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  21  14HMSSLRPRREDPPVLEEWYRRPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVMDDSVSQGGEGVRRAIADRYAGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGR-AVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVR--HADELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFVERFCLELLERHRTLLVPGTAFG----APHGARLGFGGPQEDFRAGLDGLSRFLRERAAGR...... 400
34 -80.1003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  24  21..RPSDMAKKTFNPIRAIVDNMKNKTMISLSIGDPNLPTDPEVTQAMKDALDSYNGYAPSIGFLSSREEIASYYHLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL-PEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDQRILGPCTIVQGALKSILC-RTPGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIEMEFTERLVAEQSVHCLPATCFE----YPNFIRVVITVPEVMMLEACSRIQEFCEQHYHC....... 421
35 -79.4004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  21  38.KHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSFNGYPPTVGADNLRQVVSTYWRLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLD-PSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDVPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIARTL-LKCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNLEFYEKLLDEENVQVLPGEIFG----MSGFLRATVSRPSAVLNEAVDRIIEFCERHKK........ 438
36 -79.0003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  19  74MAGYINTDGIRERLFAFLDPDKNDIDAVNYCHTELGLNRDKVVAEWVNGAV-ANNYPVPDRCLVNTEKIINYFLQAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHSEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFK--SIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDRLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYRDFLLKLAEKNGVVLVDGVGFGAK---PGELRVSQANLPTEYALIGKQVLELLKEYYEE....... 528
37 -78.9003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  23  4..RPSDMSNKTFNPIRAIVDNMKNKTVISLSIGDPNLPTDPEVTQAMKDALDSYNGYAPSIGYLSSREEVASYYHLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLL-PEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILQ-RTPQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIEMEFTERLIAEQSVHCLPATCFE----YPNFFRVVITVPEVMMLEACSRIQEFCEQ........... 400
38 -78.5003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  17  14KQNELHIKDLGMASIRDLVALVTGTKFCRMEMGVPGLPAPQIGIETEIQKLREASIYPNLDGLPELKQEASRFAKIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLF-EYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACNDEYNFRDSVIEYGRKARIMKKMFLDNGFNIVEPLADGFYFTVGSSKLIEKFVRYGMCAITLKTTG---SKRNEAMRICTSLLESQFPDLEKRLQMLNAE........... 436
39 -78.2006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  15  14.HMHPQATPAPGAPLLDLTQHEMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYEKRFTEAFFQLHRLVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID---ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPEYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVR-DSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKSVAWFRVTATDVHRLLSADGVYVLPGRYFYEPSKGDAYVRMALAREPEMFADAMALTRQVLDRHGR........ 407
40 -76.9003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  18  64...PQSLGQQPVTFFREVLALCDHPDLLQREEIKTLFSAISRAKQILAMIPRATGAYSHSQGIHGLRDAIASGIAANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLN-ESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKFHSFKKIVRPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVCSNITGQILASLVMSYASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQIDAFYALRLLESTGIVVVPGSGFGQVP-GTWHFRCTILPQEDKIPAVISRFTVFHEAFMSE....... 487
41 -75.5003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  20  1...GMKLPRFGVEEWLNVHENSAGVSISSLTLEEL-FALSGTNPEDFYKKLGTKLNYGWIEGSPAFKKSVSQLYTVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIE-EENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELD--VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALA--HYQEILERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIMEDFCLQLLQEHGVLLVPGNRFE----RDGYVRLGFACEQETLIKGLEKLSQFLRRFDKEN...... 375
42 -75.3003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  18  54.KPFTEVIRANIGDAQAMGQQPQVMALCTYLLDSPSFPEDAKARRILQACGNSLGSYSASQGVNCIREDVAAYITADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLD-EENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLSVRLCPPVSGQAAMDIVVNPPVSREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIDMFYCMKLLEETGICVVPGSGFGQRE-GTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA..... 492
43 -74.7005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  17  2........TTQPQLKENLTQ--WAYLALNSELNIADGHARQALSPGQQKIVNEPVLWAESEQRPEAHQAYFTLLGAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEED------ALHGADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSR-DAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVEAGRTGTEVWEELQRHHVFALPCRQFHEPSDGDHMVRIALSRSTEPLEKSVQVLRTVLET........... 375
44 -73.1003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  20  2MTFSLFGDKFTRRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKNYDGPQGKTALLNALAVLLRIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVSARLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNDLLRLSETIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDELLYQRLKARGVLMVPGHYFFPGPHTHQCMRMNYVPEPDKIEAGVKILAEEIERAWREG...... 417
45 -71.9002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  20  82.GIEGRFERYIAEN-RDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-GCNYPVPPRMLNISEKIVRQYII-ESVNLFAVEGGTAAMAYKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQ--SLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDDMLFRIADETGIVLLPGRGFGSN---RPSGRASLANLNEYEYAAIGRALRKMAD........... 520
46 -71.9003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  20  69MNTVGVGGLAKIEGIEGRFEVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-GCNYPVPPRMLNISEKIVRQYIIRESVNLFAVEGGTAAMAYKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINAPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQ--SLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDDMLFRIADETGIVLLPGRGFGSD---RPSGRASLANLNEYEYAAIGRLRQMADELYAQYTQQGN. 531
47 -71.5001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  20  4..LSRNATFNSHGQDSSYFLGWQENGIIQMGLAENAKNPEAAAFKKNGESIAELALFQDYHGLPAFKKAMVDFMAFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFISVMEVVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHELWKKIVYEVHLNISPGSSCHCTE--PGWFRVCFANLERTLDLAMQRLKAFVGEYYNVPEVNGG. 441
48 -71.4002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  20  82..IEGRFERFIAEH-RDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG--CNYPVPPRMLTVSEQIVRQYPPESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHAPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQ--SLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESASTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNDMLFRVADETGIVLLPGRGFGSD---RPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGK 530
49 -70.6001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  18  2..LSKLATNEEHGENSPYFDLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKAIANFQDYHGLPEFRKAIAKFMEFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEIKDLVHIVYSLSKDMGLPGFRVGIIYSFDDVVNCARKMSSFGLVSTQTQYFLAAMLS-DEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPSLWRVIINDVKLNVSPGSSFECQE--PGWFRVCFANMDDGVDIALARIRRFVGVEK......... 428
50 -70.1003if2_A mol:protein length:444 Aminotransferase  ali model follow..  19  2MKFSKFGQKFQPTGISQLMDLKSDQPVNMLGGGNPAKIDADNDTGKANSSAISMANYSNPQGDSAFIDALVGFFNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTKYRVDFEALEALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDRKQLSDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKDLDLYERLKAKGTLIVPSEYFFPGQHAHECIRMSIAADEQTLIDGIKVIGEVVRELYDNK...... 444
51 -64.2002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  18  8QSLNEQLQQSNATAFAMLSDLGQKSTTYNATIGMATNKDGKMFASSLDAMFDEIFPYAPPQGIEELRDLWQQKMLRDNSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT-YPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYLTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHDALRKHLIDKYSIGVIALNATD--------IRIAFSCEKDDIPHVFDSIAKAIDDLR......... 430
52 -60.0003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  15  2......VKLENSRKPEKISNKNISDFVVNLDHGDPTAYEEYWRKMGDRCTVTDLMSYFSDMTNPELEDAIKDLHGTEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG------------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTP-----ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNESESENFFKYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYFG-EETDLVSELRRHKVMSRAGERCGSD---KKHVRVSMLSREDVFNVFLERLANMKLIKSID....... 390
53 -59.5004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  19  6MTIKRATWNNGPDLAFDINNKANREAVINAALGTLLDDKGPSVYDRLDEMDSHIASYAPIEGEKDYRKIVIDTLFGPYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFAFNIDKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGIKEIIEEFEASLAHSARCNWSNGTHAAQNILIELEREQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTDKFDIVKDLEKENIFTIPSAKGI---------RVAICGGEEKIPKLVQRLAFYTNK........... 412
54 -58.6001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  13  51...................SEKIQGCSADVASGDGLFLEEYWKQHKEASAVMSYFFNPVSNFIFELEKTIKELHEAKDRYIVFGVGVTQLIHGLVIS-LSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYTP-----IKYKADEDILLFTMSKFTGHSGSRFGWALIKESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVARDLNTFGFKKLRERWVNITALLDQSDFSYQELPQSEYCNYFREDKDCYQTFQNGRINTQNGVGFEA---SSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRKTPLIKQ.. 433
55 -57.2003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  18  7VAAKHAKGKKLKDVIFVTAGQAQRENVVNGTLGEGNLVFLKTVKEEYLSLSSEHVGYAPIAGIPDFLCAAEKECFGNHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL---DEHNNFNHEAFQNRVKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPA-EAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTDSAICEELKKEHIYVIALANGIRIA---CGIPKCQMTGLAEKIYNAMKSLGKL.............. 418
56 -56.2003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  17  1..MFENITAAPADPILGLADLFRAPGKINLGQGVYKDETGKSVKKAEQYLLENTKNYLGIDGIPEFGRCTQELLLINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY-YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDA-EQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASG------------RVNVAMTPDNMAPLCEAIVAVL............. 396
57 -55.9004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  18  1MAMFEHIDAYPGDPILTLNENFQKDQKVNLSIGIYDAEGRIPVMGAVREAESGPKPYLPMVGLAAYRDAVQSLVARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPY-YDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVERVLGQLAGAVRSNYSNPQTYGAKVVAAVLG--TPALRKQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKLTESQVDALREVHGVYILRSG------------RMCVALNDSNVGIVADAIGKVLKSGA......... 402
58 -55.0004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  17  3VGTFENITAAPADPILGLADLFRAPGKINLGIGYKDETGKTPVLTSVKKAEETTKNYLGIDGIPEFGRCTQELLLINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY-YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDA-EQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASG------------RVNVAMTPDNMAPLCEAIVAVL............. 400
59 -55.0002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  17  1..MFENITTAPADPILGLADLLRAPGKIDLGMGVYDETGKTPVLTSVKKAEETTKNYLGIDGIPEFGRCTQELLKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY-YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDA-EQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASG------------RVNVAMTPDNMAPLCEAIVAVL............. 396
60 -54.9001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  16  1..MLGNLKPQAPDKILALMGEFRAQGKIDLGVGVYDATGHTPIMRAVHAAEETTKTYAGLSGEPEFQKAMGELILGDATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRY-FDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEETRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMASFPPFHGAKIVSTVLT--TPELRADWMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEATPEQVKRIKEEFGIYMVGDS------------RINIAGNDNTIPILARAIIEVG............. 393
61 -54.8001vp4_A mol:protein length:425 aminotransferase, putative  ali model follow..  22  14.KISKIGQNMKSSIIREILKFAADKDAISFGGGVPDPEPRKELAEIAKEIIEKEYQYSTTEGDPVLKQQILKLLGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLEDDG----MDLNVLERKLIKQVKFIVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKIPERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLLEQLKPTIELYRRKRTVMLNALEEPGVKWVKSEGGLFIWLTLPEGFDTWEM-RKKVFYVPGRVFKVYDEPSPSMRLSFCPPDEKIVEGIKRLREVVLEYGKEKH..... 417
62 -54.4001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  16  1..MFENITATTADPILGLADLFRAPGKIDLGIGYKDETGKTPVLTSVKKAEETTKNYLGIDGIPEFGRCTQELLLINDKRATPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY-YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILS--NDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKLTKEQVLRLREEFGVYAVASG------------RVNVAMTPDNMAPLCEAIVAVL............. 396
63 -54.3001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  22  18.FFSEKAMLMKASEVRELLKLVETSDVISLAGGLPAPEPVETIKKIAVEVLEEHAQYGTTKGFTPLRLALARWMEMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKG----MRVDLLEEKLEKRVKIVTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHFYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVENGYLDEHIPKIIEFYKPRRDAMLEALEE-GVEWTKPEGGMFVRVTLPEGIDTKLM-AKGVAYVPGEAFFVHRDKKNTMRLNFTVPEETIREGVRRLAETIKEEMKRVKG.... 417
64 -53.4003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  19  1..MFQKVDAYAGDPILTLMERFKSIGLYYNEDGIIPQLQAVAEAEARLNAQPGASLYLPMEGLNCYRHAIAPLLVLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPW-YDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN--DEALKASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNLSAAQVDRLREEFGVYLIASG------------RMCVAGNTANVQRVAKAFAAVM............. 397
65 -53.3005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  16  2.SWWTHVEMGPPDPILGVTEAFKRSKKMNLGVGAYRDDNPSVRKAEAQIAANLDKEYLPIGGLAEFCKASAELARFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRY-YDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVQGINVCLCQSYAKNMGLYGERVGAFTMVCKVESQLKILIRPMYSNPPLNGARIAAAILN--TPDLRKQWLQEVKGMADRIIGMRTQLVNLKKEGSTHNWQHITDLKPEQVERLIKEFSIYMTKDGRISV--AGVTSSNVGYLA--HAIHQVTK................... 401
66 -53.2004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  18  16MSLFSAVELAPRDPILGLNEAFNAPTKVNLGVGVYTNEDGKIPLLRAVRDAGLPRGYLPIDGIAAYDASVQKLLLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPY-YDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIIARVLSQLKRVIRTNYSNPPTHGGAIVAAVLA--SPELRASWVQELGEMRDRIRAMRNGLVRLKAAGIERDFSFINALTSAQVDRLREEFGIYAVSTG------------RICVALNTRNLDVVANAIAAVLK............ 414
67 -52.8003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  16  2.SWWTHVEMGPPDPILGVTEAFKRSKKMNLGVGAYRDDNGKPYVLPSVRKANLDKEYLPIGGLAEFCKASAELARFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRY-YDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVQGINVCLCQSYAKNMGLYGERVGAFTVVKRVESQLKILIRPLYSNPPLNGARIAATILT--SPDLRKQWLQEVKGMADRIISMRTQLVNLKKEGSSHNWQHITDLKPEQVERLTKEFSVYMTKDGRISV--AGVTSGNVGYLA--HAIHQVTK................... 401
68 -52.7002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  15  1..MFENITTAPADPILGLADLLRAPGKIDLGMGVYNDETGKTPVLTSVKKAETTKNYLGIDGIPEFGRCTQELLLINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAY-YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILS--NDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKLTKEQVLRLREEFGVYAVASGRLNVA-----------GMTPDNLAPLCEAIVAVL............. 396
69 -52.5004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1......MAMGKPDPILGLGQDFRMKRKVNLSIGVYDDADQPFVLECVKQATGTNMDYAPVTGIASFVEEAQKLCRIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSY-YDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLASNPPLYGAWVVSSILK--DPQLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERLTREQVELLRSEYHIYMTLNG------------RAAVSLNSTNVEYVSQAIHNVTK............ 390
70 -52.3002egy_A mol:protein length:397 Alpha-aminodipate aminotransferase  ali model follow..  25  9.AFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPEPKEEAAEAAARILREKGQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEG----PDLDALEEVLKRERPRFLYLIPQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEG--SERLERVRRVYREKAQAMLHALDR-EVRYTRPKGGMFVWMELPKGLSAEGL-EENVAFVPGGPFFANGGGENTLRLSYALDREGIAEGVRRLGRALKGL.......... 393
71 -52.0004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  14  8AQTQGPGSMGKPDPILGLGQDFRMKRKVNLSIGVYDDADQPFVLECVKQATGTNMDYAPVTGIASFVEEAQKLCRIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSY-YDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLANNPPLYGAWVVSSILK--DPQLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERLTREQVELLRSEYHIYMTLNGRAAVS-----------GLNSTNVEYVSQAIHNVTK............ 403
72 -52.0003d6k_A mol:protein length:422 Putative aminotransferase  ali model follow..  18  10..DAARLAQVREEVTAKYAELKAKNLSLDLTRGKPSLDLSNDLLSLPGGDFRTKDNYGGLLGIADIRELWAEALGLPADLVVAQDGSSLNIMFDLISSAEEKVKWLCPVPGYDRHFTITEHFGFEMINVPMTDEG----PDMGVVRELVKDPQVKGMWTVPGNPTGVTFSEQTCRELAEMSTAADFRIVWDNAYALHTLSDEFPIVHNVIENRFWFMSSTSKITH-AGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQFFGDVAGKAHMLKHAASLAPKFERVLEILDS-VAKWTSPTGGYFISVDVVPGTASRVVEEAGIALTGAGSSFHNDPNNENIRLAPSPPVAELEVAMDGFATCVLMAALE....... 421
73 -51.9005c6u_A mol:protein length:435 Aminotransferase  ali model follow..  16  6..SPQELAALHARHQQDYAALQGMKLALDLTRGKPSLDLSNQLLSLPGDDYRDPENYGGQHGLPGLRAIFAELLGIAVPNLIAGNNSSLELMHDIVAQEQDGIKFLCPVPGYDRHFAITETMGIEMIPIPMLQDG----PDVDLIEELVAVDPAIGMWTVPGNPSGVTYSWETVRRLVQMTAAPDFRLFWDNAYAVHTLTLDFPRQVDVLPNRPYVFASTSKITF-AGGGVSFFGGSLGNIAWYLQYAGKKSIGPDKVNQLRHLRFFGDADGRLHMLRHQQILAPKFALVAEVLDQ-IASWTEPKGGYFISLDVLPGTARRTVADVGIAVTEAGASFRKDPDDKNIRIAPSPSVPDLRNAVDGLATCALLAATETLLNQGL 426
74 -51.8003aov_A mol:protein length:448 Putative uncharacterized protein PH0207  ali model follow..  22  47.FFSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKPKEIIRDILVEIMEKYAQYGTTKGFTPLRETLMKWLGSQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEG----MKVEILEEKLKEKVKVVTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALEGRVIYLGTFSKILA-PGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEE-GVKWTKPEGGMFIWVTLPDGIDSKKM-KKGVAYVPGEAFYAHRDVKNTMRLNFTVDEDKIMEGIKRLAETIKEELKA....... 442
75 -51.4001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  15  1..MFENITAAPADPILGLADLFRAPGKINLGIGLYYDETGKIPVLTSVKKAETTKLYLGIDGIPEFGRCTQELLLINDKRARTGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY-YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRANYSSPPAHGASVVATILS--NDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKLTKEQVLRLREEFGVYAVASGRVNV--AGMTPDNMAPLC--EAIVAVL.................... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24