current user: public

If you have questions about the server, please let us know.

Query: 1xi9_A mol:protein length:406 putative transaminase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst AGSIRASKRALSVEYAIRDVVLPARELEKKGIKVIRLNIGDPVKFDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLKELast
1 -123.0001xi9_A mol:protein length:406 putative transaminase  ali model  100  1AGSIRASKRALSVEYAIRDVVLPARELEKKGIKVIRLNIGDPVKFDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLKE 400
2 -107.0004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  38  22.SPIEKSSKLENVYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ. 424
3 -106.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  38  1...MALSDRLELVASEIRKLFDIA----AGMKDVISLGIGEP---DFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDRHYSIASLDGFERTITVNGFSKTFAMTGWRLGFVAAPS-----WIIERMVKFQMYNATCPVTFIQYAAAKALKDERSAVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPRIRD-TGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRMERVLKERKL. 388
4 -105.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  32  4DLSKRFNKNLNKIEV---SMIRQFDQSISDIPDVLKLTLGEP---DFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT-RSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPA-----VLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVAQGQDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEFMEQYAD. 393
5 -104.0001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  35  3....GLSRRVQAMPSATVAVNAKALELRRQGVDLVALTAGEP---DFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVA-PEHTLTVNGAAKAFAMTGWRIGYACGPK-----EVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMDTSPI-APDEVRAAERLL-EAGVAVVPGTDFA--AFGHVRLSYATSEENLRKALERFARVLGR.... 384
6 -102.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  19  3SIEAKFKKLGTDNPGQEVRQSAAGLEALIRGARPVDFSHGDVD-AHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGSYTHLRAEAAAENVVTIMGPSKTESLSGYRLGVAFGSR-----AIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPK-LAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYRA. 407
7 -101.0002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  29  5KIMDVFSDRVLLTESPIRKLVPFAEMAKKRGVRIHHLNIGQP---DLKTPEVFFERI-YENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSIE-SDKVVVIDSVSKKFSACGARVGCLITRN-----EELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELP---VEDAEEFARWMLTDETTMVAPLRGFYLTGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSS 399
8 -101.0001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  33  3SDKIMVSRRISEIISKTMELDAKAKALIKKGEDVINLTAGEP---DFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEFDRIVYINGFSKSHSMTGWRVGYLISSE-----KVATAVSKIQSHTTSCINTVAQYAALKALEVDNS---YMVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVR----GDDVKFCERLLEEKKVALVPGSAFL--KPGFVRLSFATSIERLTEALDRIEDFLNSR... 383
9 -100.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  31  1...MKLAARVESVPSMTLIIDAKAKAMKAEGIDVCSFSAGEP---DFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDQHLSIGAASPEERSVVCSGFAKTYAMTGWRVGFLAGPV-----PLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAK-TGRSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDTIKRGMERLEKFLHGI... 387
10 -99.6003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  28  3....LKNSSRSAVPFIVMDVMEAARRAEEAGRRIIHMEVGQP---GTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALEL--TDECYVINSFSKYFSMTGWRVGWMVVPE-----DQVRVVERIAQNMFICAPHASQVAALAALDCDAE-LQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDL-TDDSRAFAAEILEKAGVAVTPGLDFDPEGAGTLRFSYARATADIEEGLDRLEAFMQARGE. 384
11 -99.3002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  32  2.....LSKRLLNFSFEVMDILALAQKLESEGKKVIHLEIGEP---DFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF--------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFDELEKTILINGFSKLYAMTGWRIGYVISND-----EIIEAILKLQQNLFISAPTISQYAALKAFEKETEEINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPNIG----EDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEFLNK.... 370
12 -97.6002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  23  11RGSHMISNKLANIPDSYFGKTM-GRKIEHGPLPLINMAVGIP---DGPTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENKDVAIEIYSLSKGYNMSGFRVGFAVGNK-----DMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPP--GYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTELAYLYE.. 398
13 -96.6005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  24  3....DRVALRAGVPFYVMDVWLAAAERQRTHGDLVNLSAGQP---SAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPT-----VLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDF-TSDSLAFCSKLLADTGVAIAPGIDFDTAGGSFVRISFAGPSGDIEEALRRIGSWLPS.... 387
14 -96.5001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  28  3SWDVSMSNHAGLVFNPIRTVSDNAK-PSPSPKPIIKLSVGDP---TLDKNLLTSAAQIKKLKEACNGYFPTVGSPEAREAVATWWRNELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVDPHGNGSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYKTDVEFFEKLLEEENVQVLPGTIFH--APGFTRLTTTRPVEVYREAVERIKAFCQRHAA. 415
15 -96.4005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  29  67SVDMSLSPRVQSLPSKTMVITDLAATLVQSGVPVIRLAAGEP---DFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPTHTSFASLPDYERTLTVNGFSKAFAMTGWRLGYLAGPK-----HIVAACSKLQGQVSSGASSIAQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGSDSSSLALYFLDKFQVAMVPGDAFG--DDSCIRISYATSLDVLQAAVEKIRKALEPLRAT 472
16 -95.4003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  20  25ANKYFTSNTAKDVSLTNEAAAKAANNSKNQGRELINLGQGFF---SYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEQLTLTVGSAGKSFAATGWRIGWVLSLNA----ELLSYAAKAHTRICFASPSPLQEACANSINDALKYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPKDFRISHWLINELGVVAIPPTEFYKAAENLLRFAVCKDDAYLENAVERLKLLKDYL... 447
17 -93.7001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  22  3NNPLIPQSKLPQLTTIFTQMSALA-----QQHQAINLSQGFP---DFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMAL-QPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQGHASVLAHPQRERAVAVSSFGKTYHMTGWKVGYCVAPA-----PISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSAVSTLDDVEFCQWLTQEHGVAAIPLSVFCPFPHKLIRLCFAKKESTLLAAAERLRQL....... 386
18 -93.4005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  24  1....ANAKRIEGLSNVWVEFTKLA-----ADPSVVNLGQGFP---DISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGTHVKIATLPGWERTITIGSAGKTFSVTGWKLGWSIGPA-----HLIKHLQTVQQNSFYTCATPLQAALAEAFWDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSLGADYDYKFVKWMTKHKKLTAIPVSAFCDSFEKLVRFCFIKKDSTLDAAEEIFRAW....... 410
19 -93.0001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  24  10HNKFDLPKRYQGSKSVWVEYIQLA-----AQYKPLNLGQGFP---DYHAPKYALNALAAAANSPDNQYTRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPEHIRICTLPGWERTITIGSAGKTFSLTGWKIGWAYGPE-----ALLKNLQMVHQNCVYTCATPIQEAIAVGFESPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSSLDARKDYRFTKWMTKSVGLQGIPPSAFYSEGEDFVRYCFFKKDENLQKAAEILRKWKGS.... 428
20 -92.7004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  26  33..RIASSKHAQRTLQPLNNL-TDNMKPSRSTKSNLRLSIGDPTVDNLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRFCQTKLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNIFTSVADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFKSDMEFYEKLLDEENVQVLPGEIFG--MSGFLRATVSRPSAVLNEAVDRIIEFCERHKK. 438
21 -92.4002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  24  1...MATVSRLRPYTTVFAEMSALA-----TRIGAVNLGQGFP---DEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHRHLPLAGFDGAERTITISSAAKMFNCTGWKIGWACGPA-----ELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFCKRDDTLDEAIRRLSVLAERPATG 399
22 -91.6002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  25  7.............PSVFLVVDEAKRKARERGVGLIDLSIGST---DLPPPEAPLKALAEALNDPTTYYCLKSCTLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGKERVVELFSLSKSYNLAGFRLGFALGSE-----EALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGV--LSLLPPRATMYLWGRLPE--GVDDLEFGLRLV-ERGVALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREALD..... 376
23 -91.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  28  19..SVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPTVFNLPTDPEVTQAMKDALDSGKNGYAPSIGFLSSREEIASYYHCP-EAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIGNEIRDGLVKLSQRILGPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFENDVEFTERLVAEQSVHCLPATCFE--YPNFIRVVITVPEVMMLEACSRIQEFCEQHYH. 420
24 -91.6001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  24  1...MRLHPRTEAAESIFPRMSGLA-----QRLGAVNLGQGFP---SNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFAP-ERTFTVGSAGKRLEATGYRVGWIVGPK-----EFMPRLAGMRQWTSFSAPTPLQAGVAEALKRREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAEL-------PGWDAFRLVEEARVALIPASAFYDPPKDLFRFAFCKTEEELHLALERLGRVVNSPREA 374
25 -91.6003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  20  34TIDVQRNENFGKLRAPEIARRRKAHQEKNPDAKIISLGIGDT---TEPLPKYIADAMAKATREGYSGYGAEQGQGALREAVASTFYGHAGRAA--DEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPCPKTIYEIPGDEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANVHADWNRVMTTCFNGASNIVQAGGLACLQPELKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFP---GKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEAYGKRNAS 443
26 -91.2002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  25  5SRPARRFARIDRLPYVFNITAELKMAARRRGEDIIDLSMGNP---DGPTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGKAPSIMQVPGKDIAVEFFTLSKSYNMAGWRIGFMVGNP-----ELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPEYAHLGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALIENRDRLRQAVRGIKAMFRADGL. 400
27 -90.7003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  27  2..NVRPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPTVFNLPTDPEVTQAMKDALDSGKNGYAPSIGYLSSREEVASYYHCP-EAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFNEIRDGLVKLSQRILGPCTIVQGALKSILQTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFENDVEFTERLIAEQSVHCLPATCFE--YPNFFRVVITVPEVMMLEACSRIQEFCEQH... 401
28 -90.4004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  25  2.AKQLQARRLDGIYNPWVEFVKLA-----SEHDVVNLGQGFP---DFPPPDFAVEAFQHAVSGDFNQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGQHISIASLPGWERTLTIGSAGKTFSATGWKVGWVLGPD-----HIMKHLRTVHQNSVFHCPTQSQAAVAESFEQPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDFKRKYDRRFVKWMIKNKGLVAIPVSIFYSVFDHYIRFCFVKDEATLQAMDEKLRKWKVELEN. 424
29 -90.2002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  21  21KTKVSRNSNMSKLQFPEIARRRSAHLLKYPDAQVISLGIGDT---TEPIPEVITSAMAKSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGI--GDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGEEVAMETASFSKYAGFTGVRLGWTVIPKKSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPGLEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFP---NQSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQLYK..... 426
30 -88.4003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  26  17....NLNPKVLKCEYAVREIVIHAQRLQEQLKEILYCNIGNPQSFSADSISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKFHSFKKIVRSPLVSYQSVSKGYYGECGKRGGYFEITGFSAP---VREQIYKIASVNLCSNITGQKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQIKAANKAPDAFYALRLLESTGIVVVPGSGFGQVGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSE 487
31 -87.8003ele_A mol:protein length:398 Amino Transferase  ali model follow..  23  1..GMVVNESMYQLRSAIRELFEYGKAAIVGKENVYDFSIGNP---SIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTE-HFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVT-KYYDNTLVCYSYSKSLSLPGERIGYVLVPDEDKAELYAAVCGAGRALGYVCAPSLFQKMIVKCQGATG-----DINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKAL---EDDSNAFCEKAK-EEDVLIVAADGFG--CPGWVRISYCVDREMIKHSMPAFEKIYKKYNK. 398
32 -86.9004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  21  35STKLVRNVNLEKLKNNEINRRELEHIEKHPNVQLISLGTGDT---TEPIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHV--KSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGREVAIEVSSFSKFAGFTGVRLGWSIIPDESNGFPIINDFHRIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFK---GSKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTKH 445
33 -86.4006DK6 Entity 1(prereleased)  ali follow..  20  8....FLKLKAGYLPEIARRVKAFTEGNPEAAQRLIRCGIGDV---TEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPIPHSIFEIEGRDCAIEFRSFSKNGGFTGVRCAYVVIPKSLEAQALHPLWSRRHSTKFNGASYIVQKGAEALYTDGKSQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPA--GLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAAL....... 410
34 -86.2003jtx_A mol:protein length:396 aminotransferase  ali model follow..  20  1....GMNTLLKQLPYPFARLHEAMQGISPEGMEAVPLHIGEP---KHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRDGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGKPLGCLQAAARQKLLMFTSLSKRSNVPGLRSGFVAGDA-----ELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQH-VIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVPD---GDDLAFARNLWQKAAIQVLPGRFLGNPGEGYVRIALVADVATCVKAAEDIVSLYR..... 396
35 -85.1003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  21  54....KPFTEVIRANGDAQAMGQQPITFLRQVMALCTYPLDSP---SFPEDAKARRILQACGGNSLGSYSASQGVNCIREDVAAYIRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDFHSFKKVSSNVELASFHSTSKGYMGCGYRGGYMEVIN--LHPEIKGQLVKLLS--VRLCPPVSGQAAMDIVVNPPVAGEESFEQFAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAPDMFYCMKLLEETGICVVPGSGFGQEGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEK 490
36 -84.6003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  19  2..........MTFEPYPFERLRALLKEITPKKRGLDLGIGEP---QFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMFKNVLVIHSLSKRSSAPGLRSGFIAGDS-----RLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRH-AEFFRNIYANNLKLARKIFKNTL-----IYPYSFYVYLPVQ-----NGENFAKTLYQNEGIITLPALYLGRNGADYVRLALVYDTPLLEKPLEIIETYRENH... 375
37 -83.3003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  22  1...MKRNPHFVSLTKNDLQKRVAQFRLENPQHTVINLSIGDT---TQPLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPLPKSIFEIPDRFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ--LEAIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPTQ-ANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPALQS.. 394
38 -82.6003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  17  11IREKQNELHIKDLMASIRDLVALVTNLKATGTKFCRMEMGVP---GLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKEPLYQPSVANTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREY-ALSSSALYALSSGATHSAQWGMAAMLKACNDNFRDSVIEYGRKARIMKKMFLDVYDKDGNEPLADGFYFTVGY--KGMDSSKLIEKFVRYGMCAITLKT-TGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE.... 436
39 -80.9004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  18  11RGSHMSSLRPRREPPVLEEWYRRH--LGPDIHDISSSGVHPY---SFAEIRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYA-----GGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPG-ADGGDTVSYGTLSKTFGLPGLRVGWAVAPK-----ELLTATFPLRDRTTLFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELEPQEVERFCLELLERHRTLLVPGTAFG--APHGARLGFGGPQEDFRAGLDGLSRFLRERAAG 399
40 -80.7003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  25  10..............EEWLNVHENSAIYDIAGVSISSLTLEEL----FALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYT-----GVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELD---VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANH-----QVTDILRDYRDYTMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAV--DMPMEDFCLQLLQEHGVLLVPGNRFE--RDGYVRLGFACEQETLIKGLEKLSQFLRRFDKE 374
41 -79.9003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  19  71NGIMAGYINTDGIERLFAFLDPDKNDEDKFLIDAVNYCHTEL---GLNRDKVVAEWVNGAVANN--YPVPDRCLVNTEKIINYFLQEKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVV---PYNTMLVYSYSKLFGCTGWRLGVIALNE-----KNVFDDNIAHLDKVELRQLHKRYSSVVRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTTDTNTHYYSLIDIYRLAEKEQVDFLLKLAEKNGVVLVDGVGFG-AKPGELRVSQANLPTEYALIGKQVLELLKEYYEE 528
42 -78.4001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  24  4.....LSRNATFNHGQDSSYFLGWQEYEKNPYHIIQMGLAENQLLAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFISVMEVLKDQRVHVVYSLSKDLGLPGFRVGAIYSND-----DMVVAAATKMSGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKS-GISCLNGNAGLFCWVDMRHLTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERLDLAMQRLKAFVGEYYNV 435
43 -76.0005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  14  6.....................QLKENLTQWAYLALNSELNIA---DGHARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQ-HGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGA-----DLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLQEGCRWVVIEDTGKLWPTLDLKAGLLVFSE-----DIGLPVEKIYSDILLGVSPLILALIREFSDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVER---AFAGRTGTEVW-EELQRHHVFALPCRQFHSDGDHMVRIALSRSTEPLEKSVQVLRTVLETR... 376
44 -73.6002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  16  65SYSYMTVGVGGLAKLDRFIAEHRDQEGVKFLGKSLSYVRDQL---GLDPAAFLHEMVDGILG---CNYPVPPRMLTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIDPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVC---PRNTLLVYSFSKYFGATGWRLGVIAAHKDN-----------VFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQNYYTLIDLQNVTCRSTGDMLFRVADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRALRRLADELYE 523
45 -73.1006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  11  10PRGSHMHPQATPAPAPLLDLTQHEIQALTMKYNLADAHTHQR---QSASQQSIVSRLPQLWYEA-EEGLQATYEKRFTEAFFQLHRQPTAL--VKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLY--PIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMNSGVRYLAIEDTGKTWPVQDAKCALITASD-----DIWETVYNLHTSVLLNVSPFVLNMLTQYVRSAADRLASVREVLTRNRECARKTLDGS-ILEYQEPVVKSVAWFRVDH--PELTATDVHRLLSADGVYVLPGRYFPSKGDAYVRMALAREPEMFADAMALTRQVLDRHGR. 407
46 -72.3002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  17  87..............FERYIAENRDQEGVRFLGKSLSYVRDQL---GLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAIC---PENTLLVYSFSKYFGATGWRLGVVAAHQ-----QNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDHTLKQLIRRRETTLYRELGMPPLRD-ENAVDYYTLIDLQDVTAKSTGDMLFRIADETGIVLLPGRGFG-SNRPSGRASLANLNEYEYAAIGRALRKMADELYA 524
47 -72.1001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  21  2.....LSKLATNEEDGWKAYDSDPFHPLKNPNGVIQMGLAENDWIKRNPKGSICSEGIKSF-KAIANFQDYHGLPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTQFVSIAEILDKDLVHIVYSLSKDMGLPGFRVGIIYSFND----DVVNCARKMSSGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVV-GIKCLKNNAGLFCWMDLRPLTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGVDIALARIRRFVGVEK.. 428
48 -71.5003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  17  1..GMTFSLFGDKFHSGITRLMEDLNDG-LRTPGAIMLGGGNPA-HIPAMQDYFQTLLTDMVESGKCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFSEARPLW-NPNIILCMSLSK-LGLPGSRCGIIIAND-----KTITAIANMNGIISLAPGGMGPAMMCEMIKRNRLSETVIKPFYYQRVQQTIAIIRRYERCLIHKPEGAIFLWLWFKDLP--ITTELLYQRLKARGVLMVPGHYFFPHTHQCMRMNYVPEPDKIEAGVKILAEEIERAWRE 416
49 -71.5003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  16  86.............RFERYIAENRDQEGVRFLGKSLSYVRDQL---GLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIDPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFAIC---PANTLLVYSFSKYFGATGWRLGVVAAHK-----ENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLVKQLIRRREATLYRELGT-PPQRDENAVDYYTLIDLQDVTSKSTGDMLFRIADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRLRQMADELYAQ 525
50 -71.1003if2_A mol:protein length:444 Aminotransferase  ali model follow..  16  1..GMKFSKFGQKFPTGISQLMDDLGDALKSDQPVNMLGGGNP---AKIDADNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIY-SDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADA-----KVIEAVSAMNAVVNLAPTRFGAAIATPLVANKQLSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKD-LPISTLDLYERLKAK-GTLIVPSEYFFQHAHECIRMSIAADEQTLIDGIKVIGEVVRELYDN 443
51 -63.5004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  14  1...MAMFEHIDAYGDPILTLNENFQKDPRD--QKVNLSIGIYF--DAEGRIPVMGAVREARDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAARVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGMFTYTTESQVDALREVHGVYILRSGRMCVAGLNDSNVGIVA--DAIGKVLKSGA......... 402
52 -63.4002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  14  5PLAQSLNEQLQQSATAFAMLSDLGQNMAEAKSTTYNATIGMATNKD----SSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDN----NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTALTNLHSNILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFIQTLKERYEVTKEVVYADQYH-SHWQAYDFNSGYFMAIKVHD---VDPEALRKHLIDKYSIGVIALNATD------IRIAFSCEKDDIPHVFDSIAKAIDDLR.. 430
53 -63.1005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  13  2....SWWTHVEMGPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDNYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLA--HAIHQVTK............ 401
54 -62.1003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  15  9..................KPEKISNKNIPMSDFVVNLDHGDP---TAYEEYWRKMGDRCTVTIDLMSYFSDMTEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTP-------TRRQDHDIMLFTFSKITGHAGSRIGWALVKDK----EVAKKMVEYIIVNSIGVSKESQVRTAKILNESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSAWLGTKEETDLVSELRRHKVMSRAGERCG-SDKKHVRVSMLSREDVFNVFLERLANMKLIKSID 390
55 -61.8003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  15  1.....MFQKVDAYADPILTLMERFKEDPRSDKVNLSIGLGII---PQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTSAAQVDRLREEFGVYLIASG----------RMCVAGNTANVQRVAKAFAAVM...... 397
56 -61.4001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  16  10.............ADPILGLADLFRADERPGK--IDLGIG--VYKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEG-AAMHKELIVASSYSKNFALYNERVGACTLVAADSETRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL...... 396
57 -61.3004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  10  5TLEAQTQGPGSMGKDPILGLGQDFRMDPAK--RKVNLSIGVYR--DDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPDMVPNLIVAQSFSKNFGLYGHRCGALHISTAEEAKRLVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTTREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVS--QAIHNVTK............ 403
58 -61.1004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  17  3AMPMTIKRATWNNPDLAFDINNKANAAIEKREAVINAALGTLL--KIIALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRFSNLPRNLFVVVAFSMSKSHTAYGLRSGAAVGISSSK--EIIEEFEASLAHSARCNWSNGTHAAQNILIELERELVDLRNMLKSRADVFVTAAKEN-KLTMIPYFGGFFTFIPT------DKAFDIVKDLEKENIFTIPSAKGI-------RVAICVGEEKIPKLVQRLAFYTNKK... 413
59 -61.0004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  16  1.MAVGTFENITAAPDPILGLADLFRADERPGK--INLGIGVY---DETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETRAFSQMKAAIRANYSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL----TKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............. 400
60 -61.0001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  15  10.............PDKILALMGEFRADPRQGK--IDLGVGVYK--DATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLTVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTASRIPEVLIAASCSKNFGIYRERTGCLLALCAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLTPEQVKRIKEEFGIYMVGDS----------RINIAGNDNTIPILARAIIEVG...... 393
61 -61.0004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  10  6.............PDPILGLGQDFRM--DPAKRKVNLSIGVYR--DDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPDMVPNLIVAQSFSANFGLYGHRCGALHISTAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTTREQVELLRSEYHIYMTLNGRAAVSG---------LNSTNVEYVSQAIHNVTK..... 390
62 -60.8003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  13  2....SWWTHVEMGPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDNYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEERVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLA--HAIHQVTK............ 401
63 -60.4001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  15  3TWTMKAAEEAEAVANECNTCYTGPDCSEKIQGCSADVASGDG---LFLEEYWKQHKEASAVRMSYFFNPVSNFIFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT------PIKYKADEDILLFTMSKFTGHSGSRFGWALIKDE----SVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPEWEEDKDCYQTFQNGRINTQNGVGFE-ASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRKT 428
64 -60.3002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  15  1.....MFENITTAPDPILGLADLLRADERP--GKIDLGMGVY---NDETGKTPVLTSVKKANETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEG-AAMHKELIVASSYSKNFGLYNERVGACTLVAADSETRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLC--EAIVAVL............. 396
65 -60.2003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  17  5.TSVAAKHAKGKKKDVIFVTAGQAQAKENGRENVVNGTLGAIHD-NLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIEFFEVNKSTSRATWSNICRPAMRTMANIVADPEAERNCYYQLIRDRADIFKQEAAQV-GLPMLPYRGGFFITIPTD-----SANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL....... 418
66 -60.0003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  10  3.............PVLVFKLTADFREDPDPRKVNLGVGACHP---WVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR-GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAISEGFEFFCAQSFSKNFGLYNERVGNLTVVGKESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATVTKIAENLYFQSDYKDDDDK. 416
67 -59.9004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  11  13PGSMSLFSAVELAPDPILGLNEAFNA--DTRPTKVNLGVGVY---TNEDGKIPLLRAVRVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAA-AAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDERVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSYSTSAQVDRLREEFGIYAVSTG----------RICVALNTRNLDVVANAIAAVLK..... 414
68 -59.5002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  15  1.....MFENITTAPDPILGLADLLRADERP--GKIDLGMGVYN--DETGKTPVLTSVKKAENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEG-AAMHKELIVASSYSKNFGLYNERVGACTLVAAETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL----TKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............. 396
69 -59.4001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  10.............ADPILGLADLFRADERP--GKINLGIGLY---YDETGKIPVLTSVKKAEETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEG-AAMHKELIVASSYSKNFGLYNERVGACTLVAADSETRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............. 396
70 -59.2003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  14  1.....MFENITAAPDPILGLADLFRADERP--GKINLGQGVYK--KTPVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEG-AAMHKELIVASSYSKNFGLYNERVGACTLVAAETVDRAFSQMKAAIYANYSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL----TKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL...... 396
71 -59.0003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  21  3...........QFPSIEDLRARNTMKWTRYGQGVLPLWVAE---SDFSTCPAVLQAITDAVQREAFGYQPDGS--LLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT----GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVSDTSVCITITAPSKAWNIAGLKCAQIIFSNP----SDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKIPGAKITPMQATYLMWIDFRDTT---EGSPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT.. 377
72 -56.8001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  15  1.....MFENITAAPDPILGLADLFRADERPGK--INLGIGVYK--DETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASG----------LVNVAGTPDNMAPLCEAIVAVL...... 396
73 -56.1004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  16  1.MAVGTFENITAAPDPILGLADLFRADERPGK--VDLGIG--VYKDETGKTPVMTSVKKAEQETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASG----------RVNVAMTPDNMAPLCEAIVAVL...... 400
74 -55.5001c7n_A mol:protein length:399 CYSTALYSIN  ali model follow..  20  1.MIYDFTTKISRKNLGSLKWDLMYSQNPEVGNEVVPLSVAD---MEFKNPPELIEGLKKYLDETVLGYTGPT--EEYKKTVKKWMKDRHQWDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELLEKDGYTIDFQKLEKLSDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGEHTVFQSIDEQDKTITFTAPSKTFNIAGMGMSNIIIKNPDIRERFTKS---RDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVHPEIKAPLIEGTYLQWIDFRAL-KMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSSVIQESLERLNKALKDLKNR 396
75 -55.0003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  20  22.............................KNEELIHAWIAD---MDFEVPQPIQTALKKRIEHPIFGYTLPP--ENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADTHTPFASLSEEARTITCMAPSKTFNIAGLQASIIIIPNEKLRQAFTSI---QYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDIPTLSVMKPEGSFLLWIDCSAL-NLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS..... 383

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.