current user: public

If you have questions about the server, please let us know.

Query: 1yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MSSTSNETMHNKFDLPKRYQGSTKSVWVEYIQLAAQYKPLNLGQGFPDYHAPKYALNALAAAANSPDPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTISSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETELKRLKSPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSLDSKVDLTQETDARKDYRFTKWMTKSVGLQGIPPSAFYSEPNKHLGEDFVRYCFFKKDENLQKAAEILRKWKGSSLast
1 -130.0001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model  100  1MSSTSNETMHNKFDLPKRYQGSTKSVWVEYIQLAAQYKPLNLGQGFPDYHAPKYALNALAAAANSPDPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTISSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETELKRLKSPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSLDSKVDLTQETDARKDYRFTKWMTKSVGLQGIPPSAFYSEPNKHLGEDFVRYCFFKKDENLQKAAEILRKWKGSS 429
2 -120.0005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  55  1.............ANAKRIEGLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAA---IDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGKWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNSDE-PYDYKFVKWMTKHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDSTLDAAEEIFRAW.... 410
3 -118.0004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  47  1.........MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFM-LNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVE. 421
4 -111.0003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  33  16MSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAAQGRELINLGQGFFSYSPPQFAIKEAQKALDIP--MVNQYSPTRGRPSLINSLIKLYSPIYNTELKA-ENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEQRNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALK-----IGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKVKIPEDYPYPEEILKDFRISHWLINELGVVAIPPTEFYIKEHEKAAENLLRFAVCKDDAYLENAVERLKLLKDY. 446
5 -111.0001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  32  2........TNNPLIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQG---ANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPP---------HFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLR-------AEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAV----------STLDDVEFCQWLTQEHGVAAIPLSVFCADPF---PHKLIRLCFAKKESTLLAAAERLRQL.... 386
6 -108.0002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  35  1............MATVSRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGG---VNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPD-------GRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALD-------TEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPLGYD----------DSTEFCAALPEKVGVAAIPMSAFCDPQQADVWNHLVRFTFCKRDDTLDEAIRRLSVLAER. 395
7 -106.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  27  1............MALSDRLELVSASEIRKLFDIAAGKDVISLGIGEPDFDTPQHIKEYAKEALDKGL---THYGPNIGLLELREAIAEKLKKQNGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEE--------DEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERS-----WKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDT-----------GLTSKKFSELMLKEARVAVVPGSAFGKA-----GEGYVRISYATAYEKLEEAMDRMERVLKE. 385
8 -103.0001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  32  1............MRLHPRTEAAKESIFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGR----QDQYAPPAGLPALREALAEEFAVE-------PESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLT-------PEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGE-RPRRLREF--APERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLA-----RREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG-----------------WDAFRLVEEARVALIPASAFYLEDP---PKDLFRFAFCKTEEELHLALERLGRVVNS. 370
9 -102.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  26  3........MDLSKRFNKNLNKIEVSMIRQFDQSISDPDVLKLTLGEPDFATPKHIKEAAKRAIDADE---SHYTGMAGLLALRQAASAFVKEKYHLTYNPDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSN---------DFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY--LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALT-------NGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVAQ----------GQDSFKFLQDFAKEKAVAFIPGVAFGKY-----GEGYLRISYAASMETIKEAMKRLKEFMEQ. 390
10 -99.8003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  19  2........MSIEAKFKKLGTDNAPGQEVRQSAAGLEARPVDFSHGDVDAPTPGAFDLFSAGVQSGG---VQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYV----SADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFD-------EAPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPKL-----------AVAPAEFVKILRLQAGVVVTPGTEFSPH-----TADSVRLNFSQDHEAAVAAARRIVTLVER. 404
11 -99.3002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  19  3.SSSSGLVPRGSHMISNKLANIPDSYFGKTMGRKGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPEN--QKYGAFHGKEAFKQAIVDFYQRQYNVTLDKEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPP---------HYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDA-KNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALN-------HYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPP------------GYDSEQFEQFLVQEKSILVAPGKPFGEN-----GNRYVRISLALDDQKLDEAAIRLTELAYL. 396
12 -98.0001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  27  3.............GLSRRVQAMKPSATVAVNAKAQGVDLVALTAGEPDFDTPEHVKEAARRALAQGK---TKYAPPAGIPELREALAEKFRRENGLSVTP-EETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPE--------EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EHFSPGRV--APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEA----SRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPI-----------APDEVRAAERLL-EAGVAVVPGTDFA-------AFGHVRLSYATSEENLRKALERFARVLGRA 385
13 -95.9001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  25  3.........SDKIMVSRRISEIPISKTMELDAKAKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGE---VKYTDPRGIYELREGIAKRIGERYKKDISP-DQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMS--------KNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTD-EFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDN----------SYMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRG--------------DDVKFCERLLEEKKVALVPGSAFL-------KPGFVRLSFATSIERLTEALDRIEDFLNSR 383
14 -94.8002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  26  2..............LSKRLLNFESFEVMDILALAEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGK---THYTDSRGILELREKISELYKDKYKADIIP-DNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF----------------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEG-KCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKET------EREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGE--------------DGREFAYKLLKEKFVALTPGIGFGSK-----GKNYIRISYANSYENIKEGLERIKEFLNK. 370
15 -93.5001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  23  1............MKLAARVESVSPSMTLIIDAKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGK---TRYGPAAGEPRLREAIAQKLQRDNGLCYGA-DNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVE--------TQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAAPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYE-------NSQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAKT-----------GRSSLDFCSELLDQHQVATVPGAAFG-------ADDCIRLSYATDLDTIKRGMERLEKFLHG. 386
16 -93.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  24  1.........AGSIRASKRALSV-EYAIRDVVLPAKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGH---NYYGDSEGLPELRKAIVEREKRKNGVDITP-DDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEE--------EDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTK-DVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLT-------GPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIEVG----------PWKNDKEFVLDVLHNAHVLFVHGSGFGEY-----GAGHFRAVFLPPIEILEEAMDRFEKFMKE. 396
17 -93.0002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  22  3.......AESRPARRFARIDRLPPYVFNITAELKRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDT--HGYSTSRGIPRLRRAISHWYRDRYDVQIDPESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPG--------IDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALE-------GDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEPY---------AHLGSLEFAKKLLQDAKVSVSPGIGFGDY-----GDDHVRFALIENRDRLRQAVRGIKAMFRA. 397
18 -92.9005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  24  59.NDAETLSSSVDMSLSPRVQSLKPSKTMVITDLASGVPVIRLAAGEPDFDTPKVVAEAGINAIREGF---TRYTLNAGITELREAICRKLKEENGLSYAP-DQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKIS--------NNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGLG----KAGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSAYYGSEAEGFGLI-NDSSSLALYFLDKFQVAMVPGDAFG-------DDSCIRISYATSLDVLQAAVEKIRKALEP. 468
19 -91.9002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  20  2......GSDKIMDVFSDRVLLTEESPIRKLVPFARGVRIHHLNIGQPDLKTPEVFFERIYEN----KPEVVYYSHSAGIWELREAFASYYKRRQRVDVKP-ENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRME--------EGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRG-EFASALSIES--DKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLN-------LDDSFFDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELP-------------VEDAEEFARWMLTDFNTMVAPLRGFYLTPG--LGKKEIRIACVLEKDLLSRAIDVLMEGLKM. 395
20 -91.3003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  21  3.............LKNSSRSAVDPFIVMDVMEAAAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDA---LGYTVALGLPALRQRIARLYGEWYGVDLDP-GRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPE--------NRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAV----TALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALD--------CDAELQANLDVYKANRKLMLERLPKAGTRIAPPDGAFYVYADVSDL-----------TDDSRAFAAEILEKAGVAVTPGLDFDPER----GAGTLRFSYARATADIEEGLDRLEAFMQA. 381
21 -90.3003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  17  25VQAVAQRAGTIDVQRNENFGKLRAGYLKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAG-REGYSGYGAEQGQGALREAVASTFYGHAGRAAD---EIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPD---NHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPE------GLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGK-------------PSWDVFAEILERCNIVTTPGSGYGPA-----GEGFVRASAFGSRENILEAVRRFKEAYGK. 439
22 -90.2005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  22  3.............DRVALRAGVPPFYVMDVWLAATHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQ---LGYSVALGIPELRDAIAADYQRRHGITVEP-DAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQ--------TRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA--WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPE------ATAEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDF-----------TSDSLAFCSKLLADTGVAIAPGIDFDTAR----GGSFVRISFAGPSGDIEEALRRIGSWLPSQ 388
23 -89.8002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  21  3...................RVPEPSVFLVVDEAKRGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTT--YGYCLKSCTLPFLEEAARWYEGRYGVGLDPRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLR----------EDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEG-EAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALK-------TPKEVVRGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPE------------GVDDLEFGLRLV-ERGVALAPGRGFGPG-----GKGFVRIALVRPLEELLEAAKRIREALD.. 376
24 -89.6004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  17  13.ENLYFEGAMSPIEKSSKLENVCYDIRGPVLKEAEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA----QGYCDSKGLYSARKAIMQHYQARGMRDVTV-EDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDES--------SDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPL-APDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAGLEMLASMRLCANVPAQHAIQTALGGYQSISE-----FITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDAKRFNIH--------DDQKMVLDFLLQEKVLLVQGTAFNWP-----WPDHFRIVTLPRVDDIELSLSKFARFLSG. 421
25 -88.8003jtx_A mol:protein length:396 aminotransferase  ali model follow..  19  1.............GMNTLLKQLKPYPFARLHEAMQGMEAVPLHIGEPKHPTPKVITDALTASLHEL----EKYPLTAGLPELRQACANWLKRRYGLTVDADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCP---------APSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWD--------DEQHVIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPD-------------GDDLAFARNLWQKAAIQVLPGRFLARDTEGNPGEGYVRIALVADVATCVKAAEDIVSLYR.. 396
26 -86.6002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  15  13.TPQEKIEYKTKVSRNSNMSKLQAGYLFPEIARYPDAQVISLGIGDTTEPIPEVITSAMAKKAHE-IEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDD---DVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMR-----NGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDD-NPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPE------GLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQ-------------SSWDVFAEILEKTHVVTTPGSGFGPG-----GEGFVRVSAFGHRENILEACRRFKQLYK.. 426
27 -86.4001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  19  1........MSSWDVSMSNHAGLVFNPIRTVSDNAKPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEASQECNGYFPTVGSPEAREAVATWWRNSFVHKEELKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPE--------NDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDFTSVADFETT-VPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLN-------TPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDLEKYR-------DIKTDVEFFEKLLEEENVQVLPGTIFH-------APGFTRLTTTRPVEVYREAVERIKAFCQR. 412
28 -86.3006DK6 Entity 1(prereleased)  ali follow..  14  2.......ALINENFLKLKAGYLFPEIARRVKAFTAAQRLIRCGIGDVTEALPEAVRYAMHEAVDENRSTFKGYGPEQGYDFLRNAIADNDYKARGLPIEA-DEIFISDGSKCDTGN-ILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYLKC---TPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKSRRHSTKFNGASYIVQKGAEALYTDE------GKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPA------------GLTSWQMFDKMLNEANVVITPGSGFGSA-----GEGYFRISAFNSRANVEEVCRRIAAL.... 410
29 -86.3003ele_A mol:protein length:398 Amino Transferase  ali model follow..  18  1...........GMVVNESMYQLVRSAIRELFEYGKKENVYDFSIGNPSIPAPQIVNDTIKELVTDYDSALHGYTSAQGDVETRAAIAEFLNNTHGTHFNA-DNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTE---------HFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKV---PFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGAT------------GDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKAL-------------EDDSNAFCEKAK-EEDVLIVAADGFG-------CPGWVRISYCVDREMIKHSMPAFEKIYKK. 395
30 -83.3004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  15  27.FEMKKLGGSTKLVRNVNLEKLKNNYLFPEINRHPNVQLISLGTGDTTEPIPEQITSHMSNFAHG-VEGYRGYGLEQGNKTLRKAIAETFYRDLHVKSN---EVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKT-KKYQNVVYMPCGPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDG-SPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLS------SGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGS-------------KSWDVFNEILENTHIITVPGSGFGPG-----GEEYLRISGFGRRDHIVEASKRLQNFFNT. 441
31 -82.2003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  15  2MNFPIDEKLIREKQNELHIKDLGMASIRDLVALVTGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVA--SIYPNLDGLPELKQEASRFAKLFVNIDIPA-RACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEY--------RGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACND----GEYNFRDSVIEYGRKARIMKKMFLDNGFNIVEPLADGFYFTVGY------------KGMDSSKLIEKFVRYGMCAITLKTTGSK------RNEAMRICTSLLESQFPDLEKRLQMLNAEG 437
32 -82.1003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  18  2...................MTFEPYPFERLRALTPKKRGLDLGIGEPQFETPKFIQDALKNHTHS----LNIYPKSAFEESLRAAQRGFFKRRFKIELKE-NELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKE--------NDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPEACMLAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWL--------DDRHAEFFRNIYANNLKLARKIFKNT----LIYPYSFYVYLPVQ---------------NGENFAKTLYQNEGIITLPALYLGRNR---IGADYVRLALVYDTPLLEKPLEIIETYREN. 374
33 -82.1004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  19  26.DRWTSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGK--FNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPS--------KSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTN-VPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIARTL------LKCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNLSYFQ-------DLKSDMEFYEKLLDEENVQVLPGEIFG-------MSGFLRATVSRPSAVLNEAVDRIIEFCER. 435
34 -81.7003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  17  1............MKRNPHFVSLTKNYLAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSTTCRGYGPDFGLPALRQKLSEDFYR----GFVDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQE--------NAFFPEFPE-----DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ---------LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQA-----------NISDRDLFDFFLREYHIAITPGIGFGRS-----GSGFVRFSSLGKREDILAACERLQMAPAL. 392
35 -81.2003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  13  54.....DEILYCNIGNPQSLGQQPVTFFREVLALCDHPDLLQREEIKTLFSAISRAKQILAMIPGRA---TGAYSHSQGIHGLRDAIASGIASRDGFPANA-DDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNES--------TGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKKFHSFKKIEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVCSNITGQILASLVMKASDESYASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQVP----GTWHFRCTILPQEDKIPAVISRFTVFHEA. 483
36 -81.0003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  18  7LGTENLYFQSMWSVRPSDMAKKTFNPIRAIVDNMKNKTMISLSIGDPNLPTDPEVTQAMKDALDSGK--YNGYAPSIGFLSSREEIASYYHCP-EAPLEA-KDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPE--------KSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATL-STDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDQRILGPCTIVQGALKSILC------RTPGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIEMEHFP-------EFENDVEFTERLVAEQSVHCLPATCFE-------YPNFIRVVITVPEVMMLEACSRIQEFCEQ. 417
37 -80.8003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  15  62VTESKLTINNGIMAGYINTDGIRERLFAFLDPDKNDIDAVNYCHTELGLNRDKVVAEWVNGAVAN-----NYPVPDRCLVNTEKIINYFLQELSDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLH------SYEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSV-----VPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDPDKIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYRLAEKI-RDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAK------PGELRVSQANLTEDYALIGKQVLELLKE. 524
38 -79.7003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  18  4..............RPSDMSNKTFNPIRAIVDNMKNKTVISLSIGDPNLPTDPEVTQAMKDALDSGK--YNGYAPSIGYLSSREEVASYYHCP-EAPLEA-KDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPE--------KSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATL-STNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILQ------RTPQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIEMEHFP-------EFENDVEFTERLIAEQSVHCLPATCFE-------YPNFFRVVITVPEVMMLEACSRIQEFCEQ. 400
39 -79.1006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  14  1MGSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA----EEGLQATYEKRFTEAFFQLHRQPTAL---VKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID----------ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVR------DSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKSVAWFRVDH------------PELTATDVHRLLSADGVYVLPGRYFYWSEPSK-GDAYVRMALAREPEMFADAMALTRQVLDR. 404
40 -78.6003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  15  42.GEIELELQRGIKKPFTEVIRANIGDAQAMGQQPQVMALCTYLLDSPSFPEDAKKR-ARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEE--------NCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSRVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQRE----GTYHFRMTILPPVEKLKTVLQKVKDFHIN. 486
41 -78.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  18  3.SSSSGLVPRGSHMSSLRPRREDPPVLEEWYRRPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVV---MDDSVSQGGEGVRRAIADRYAGG------DADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAV--------RDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWE---VLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHA-------DELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFRELERA-----AAGPQEVERFCLELLERHRTLLVPGTAFGA-------PHGARLGFGGPQEDFRAGLDGLSRFLRE. 395
42 -76.3005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  16  2....................TTQPQLKENLTQ--WAYLALNSELNIADGHARQALSPGQQKIVNELP---VLWAESEQRPEAHQAYFTLLGQ-HGYPAEP-GRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEED-------------ALHGADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAA-HYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSR------DAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVE--------------AFAGRTGTEVWEEL-QRHHVFALPCRQFH--AEPSDGDHMVRIALSRSTEPLEKSVQVLRTVLETR 376
43 -74.3002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  14  69MTTVGVGGLAKIDGIEGRFERYIAEN-RDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-----GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSENLFAVEGGTAAMAYKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADP------SLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAI-----CPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEA-VKQSSTGDMLFRIADETGIVLLPGRGFGSN------RPSGRASLANLNEYEYAAIGRALRKMADE 521
44 -73.7003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  19  1...............GMKLPRFGVEEWLNVHENSAGVSISSLTLEEL-FALSGTNPEDFYKKLQGTK---LNYGWIEGSPAFKKSVSQLYTG-------KPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEE--------NGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSEL-----DVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALA-------HYQEILERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIA------------VDMPMEDFCLQLLQEHGVLLVPGNRFE-------RDGYVRLGFACEQETLIKGLEKLSQFLRR. 370
45 -73.4001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  18  4..............LSRNATFNSHGQDSSYFLGWQEYGIIQMGLAENAKNPEAAAFKKNGESIFAE---LALFQDYHGLPAFKKAMVDFMAEIRGVTFDP-NHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCT--------SSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSS-FGLVSSQTQHLLSAMLSD----KKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLL------RSNTFEAEMELWKKIVYEVHLNISPGSSCHCTE-----PGWFRVCFALPERTLDLAMQRLKAFVGE. 431
46 -73.3003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  13  57FAAAESELSYSYMNTVGVGGLAKIEGIEGRFEVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-----GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSENLFAVEGGTAAMAYKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADP------ALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSL-----FAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDVTSKLYGEA-VKQSSTGDMLFRIADETGIVLLPGRGFGSD------RPSGRASLANLNEYEYAAIGRALRQMADE 521
47 -71.6002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  13  58..AAAESELSYSYMTVGVGGLAKLDGIEGRFEVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG------CNYPVPPRMLTVSEQIVRQYIVREMAGGAESVDLFAVEGGTAAMAYRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADP------DNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSV-----CPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAAVQQSSTGDMLFRVADETGIVLLPGRGFGS------DRPSGRASLANLNEYEYAAIGRALRRLADE 520
48 -71.1003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  15  2............MTFSLFGDKFTRRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKDALCNYDGPQGKTALLNALAVLLRETLGWDIEP-QNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVSARPN---ELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVP-FPGIIFSEARPL--WNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRN----DLLRLSETVIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDL------------PITTELLYQRLKARGVLMVPGHYFFPGLDKPHTHQCMRMNYVPEPDKIEAGVKILAEEIERA 413
49 -70.3001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  17  2..............LSKLATNEEHGENSPYFDLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKA----IANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVLIPIHCE--------SSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEKDLVHIVYSLSKDMGLPGFRVGIIYSFDDVVNCARKMSSFGLVSTQTQYFLAAM------LSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPLL------RESTFDSEMSLWRVIINDVKLNVSPGSSFECQE-----PGWFRVCFAMDDGTVDIALARIRRFVGV. 426
50 -68.5003if2_A mol:protein length:444 Aminotransferase  ali model follow..  13  2............MKFSKFGQKFQPTGISQLMDLKSDQPVNMLGGGNPAKIDAVN-DNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTS-ENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGEEG-KYRVDFEALEALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNI---IYSDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVAND----RIKQLSDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKDL-----------PISTLDLYERLKAK-GTLIVPSEYFFPGSDYQHAHECIRMSIAADEQTLIDGIKVIGEVVRE. 439
51 -67.4002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  15  1.....GAMNPLAQSLNEQLQQSNATAFAMLSDLGQKSTTYNATIGMATNKDGKMFASSLDAMFND-PDEIFPYAPPQGIEELRDLWQQKMRDNPELSIDNMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT---------PIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHDV-------------DPEALRKHLIDKYSIGVIALNATD-----------IRIAFSCEKDDIPHVFDSIAKAIDD. 428
52 -61.3003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  12  2..................VKLENSRKPEKISNKNISDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTNPELEDAIKDLHGVVGNAATED-RYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-------------------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHY--------TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNETCKSESESENFFKYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYFGKSLESYPA----AWLGTKEETDLVSELRRHKVMSRAGERCGS------DKKHVRVSMLSREDVFNVFLERLANMKLIK 387
53 -61.2004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  12  1.......SNAMPMTIKRATWNNGPDLAFDINNKANAAAVINAALGTLLDDKGPSVYDRLDEMDRSH---IASYAPIEGEKDYRKIVIDTLFGPYKP--EGYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFA------NIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGIKEIIEEFEASLAHSARCNWSNGTHAAQNILIERAENKKIYEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTD----------------KAFDIVKDLEKENIFTIPSAKGI------------RVAICGGEEKIPKLVQRLAFYTNKK 413
54 -59.8001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  11  1..............MLGNLKPQAPDKILALMGEFRAQGKIDLGVGVYDATGHTPIMRAVHAAEQRETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAE--------TRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEHRGMFSRLGA--------TPEQVKRIKEEFGIYMVGDS---------------RINIAGNDNTIPILARAIIEVG... 393
55 -59.3003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  14  1......SNAMTSVAAKHAKGKKLKDVIFVTAGQAQRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEH---VGYAPIAGIPDFLCAAEKECFGNFRP--EGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDE---------HNNFNHEAFQNRVKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADP-AKFKEYEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD---------------SANAICEELKKEHIYVIALANGI-----RIAACGIPKCQMTGLAEKIYNAMKSLGKL.... 418
56 -59.3001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  10  15VANINCSEHGRAFLDGIISEGSPKCECNTCYSEKIQGCSADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFFNPVSFELEKTIKELHEVVGNAAAKD-RYIVFGVGVTQLIHGLVISLDAPESKVVAHAPFYPVFREQTKYFDK----------------KGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT--------PIKYKADEDILLFTMSKFTGHSGSRFGWALIKESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKT-RDLNTFGFKKLRERWVNITALLDQSDFSYQELPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFEA------SSRYVRLSLIKTQDDFDQLMYYLKDMVKAK 425
57 -59.0003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  1..............MFENITAAPADPILGLADLFRAPGKINLGQGVYKDETGKSVKKAEQYLLENETT--KNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDA--------ENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIYANYSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFIIKQNGMFSFSGL--------TKEQVLRLREEFGVYAVASG---------------RVNVAMTPDNMAPLCEAIVAVL... 396
58 -58.6004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  13  1............MAMFEHIDAYPGDPILTLNENFQKDQKVNLSIGIYDAEGRIPVMGAVREAETA-DSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEA--------TGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDAAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKQRGMFTYTGL--------TESQVDALREVHGVYILRSG---------------RMCVAGNDSNVGIVADAIGKVLKS. 400
59 -58.0001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  1..............MFENITATTADPILGLADLFRAPGKIDLGIGYKDETGKTPVLTSVKKAEQYLNETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAE--------NHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSFSGL--------TKEQVLRLREEFGVYAVASG---------------RVNVAMTPDNMAPLCEAIVAVL... 396
60 -57.5002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  1..............MFENITTAPADPILGLADLLRAPGKIDLGMGVYDETGKTPVLTSVKKAEQY-NETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDA--------ENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQE-LTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFIIKQNGMFSFSGL--------TKEQVLRLREEFGVYAVASG---------------RVNVAMTPDNMAPLCEAIVAVL... 396
61 -57.3004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  13  2...........AVGTFENITAAPADPILGLADLFRAPGKINLGIGYKDETGKTPVLTSVKKAEQYENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDA--------ENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANDFSFIIKQNGMFSFSGL--------------TKEQVLRLREEFGVYAVASG---------------RVNVAMTPDNMAPLCEAIVAVL... 400
62 -57.2004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  14  5.TLEAQTQGPGSMSLFSAVELAPRDPILGLNEAFNAPTKVNLGVGVYTNEDGKIPLLRAVRDAEK-AGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAK--------TNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVRLKAAGIERDFSFINAQRGMFSYSGL--------TSAQVDRLREEFGIYAVSTG---------------RICVALNTRNLDVVANAIAAVLK.. 414
63 -56.9005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  12  2.............SWWTHVEMGPPDPILGVTEAFKRSKKMNLGVGAYRDDNPSVRKAEAQIAAKNLD---KEYLPIGGLAEFCKASAELALGENSEVLKSGRQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPK--------TCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVNLKKEGSTHNWQHITDQIGMFCFTGL--------KPEQVERLIKEFSIYMTKDGRISVA-----GVTSSNVGYLA--HAIHQVTK......... 401
64 -56.8003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  13  1..............MFQKVDAYAGDPILTLMERFKSIGLYYNEDGIIPQLQAVAEAEARLNAQPHGA---SLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRATIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEA--------TNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNQRGMFSYTGL--------SAAQVDRLREEFGVYLIASG---------------RMCVAGNTANVQRVAKAFAAVM... 397
65 -56.5003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  12  2.............SWWTHVEMGPPDPILGVTEAFKRSKKMNLGVGAYRDDNGKPYVLPSVEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPK--------TCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVNLKKEGSSHNWQHITDQIGMFCFTGL--------KPEQVERLTKEFSVYMTKDGRISVA-----GVTSGNVGYLA--HAIHQVTK......... 401
66 -56.3004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1..................MAMGKPDPILGLGQDFRMKRKVNLSIGVYDDADQPFVLECVKQATLGTN---MDYAPVTGIASFVEEAQKLCFGPTCAALRDGRQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPA--------TKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYFVPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMMAYTGL--------TREQVELLRSEYHIYMTLNG---------------RAAVSLNSTNVEYVSQAIHNVTK.. 390
67 -56.0002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  1..............MFENITTAPADPILGLADLLRAPGKIDLGMGVYNDETGKTPVLTSVKKAEQ-NETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDA--------ENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGMFFFGGL--------TKEQVLRLREEFGVYAVASGRLNVA--------------GMTPDNLAPLCEAIVAVL... 396
68 -55.7004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  11  2......AMGTLEAQTQGPGSMGKPDPILGLGQDFRMKRKVNLSIGVYDDADQPFVLECVKQATLGTN---MDYAPVTGIASFVEEAQKLCFGPTCAALRDGRQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPA--------TKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYFVPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMMAYTGL--------TREQVELLRSEYHIYMTLNGRAAVS--------------GLNSTNVEYVSQAIHNVTK.. 403
69 -55.4001vp4_A mol:protein length:425 aminotransferase, putative  ali model follow..  18  1MGSDKIMVVNLEGKISKIGQNMKSSIIREILKFAADKDAISFGGGVPDPEPRKELAEIAKEIIEKEYHYTLQYSTTEGDPVLKQQILKLLERMYGITGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLEDDG-----------MDLNVLERKLIKQVKFIVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKIGG-PERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYD------LEQLKPTIELYRRKRTVMLNALEEPGVKWVKSEGGLFIWLTLPE------------GFDTWEMFEYAKRK-KVFYVPGRVFKVYDE---PSPSMRLSFCPPDEKIVEGIKRLREVVLE. 411
70 -54.9001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  1..............MFENITAAPADPILGLADLFRAPGKINLGIGLYYDETGKIPVLTSVKKAEQ-NETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDA--------ENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSFSGL--------TKEQVLRLREEFGVYAVASGRVNV-----AGMTPDNMAPLC--EAIVAVL.......... 396
71 -54.7003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  11  1.....................MQPVLVFKLTADFRGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLN---HEYLPILGLAEFRSCASRLALGDDSPALKEKGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFL----NDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRRLEALKTPGTWNHITDQIGMFSFTGL--------NPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIAENLYFQSDYKDDD 414
72 -54.4001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  18  6.KKLSAEPINFDSFFSEKAMLMKASEVRELLKLVETSDVISLAGGLPAPEPVETIKKIAVEVLEEHADKALQYGTTKGFTPLRLALARWMEKRYDIPMSK-VEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKG-----------MRVDLLEEKLGKRVKIVTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHFDD-YGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVENGY------DEHIPKIIEFYKPRRDAMLEALEE-GVEWTKPEGGMFVRVTLPE------------GIDTKLMMERAVAK-GVAYVPGEAFFVHRD---KKNTMRLNFTYPEETIREGVRRLAETIKE. 410
73 -53.4001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  1..............MFENITAAPADPILGLADLFRAPGKINLGIGVYDETGKTPVLTSVKKAEQYENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAE--------NHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAELRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSFSGL--------TKEQVLRLREEFGVYAVASG---------------LVNVAGTPDNMAPLCEAIVAVL... 396
74 -53.1002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  21  1........MDYTKYLAGRANWIKGSALADVMKKASELKLISLAAGDPDPELPRAVLGEIAKEVLEKEPKSVMYTPANGIPELREELAAFLKKYDHLEVSP-ENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG-----------MRVDLLEEKIKQKVKLITIPTGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDN-EGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKRGY-----EKYHLEGALLGYKEKRDIMLKALEN-NAEFTKPIAGMFVMFFLPE------------GADGISFANELMEREGVVVVPGKPFYTDES---GKNAIRLNFSRSKEEIPIGIKKLAKLYKEK 404
75 -52.5004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  2...........AVGTFENITAAPADPILGLADLFRAPGKVDLGIGYKDETGKTPVMTSVKKAEQYENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAE--------NHTLDFDALINSLQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVTLQEKGANRDFSFIIKQNGMFSFSGL--------TKEQVLRLREEFGVYAVASG---------------RVNVAMTPDNMAPLCEAIVAVL... 400

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.