current user: public

If you have questions about the server, please let us know.

Query: 1ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# Score Template Links and tools%idFirst MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDLAMQRLKAFVGEYYNVPEVNGGSQSSHLSHSRRQSLTKWVSRLSFDDRGPIPGRLast
1 -134.0001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model  100  1MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDLAMQRLKAFVGEYYNVPEVNGGSQSSHLSHSRRQSLTKWVSRLSFDDRGPIPGR 473
2 -114.0001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  55  1..ILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDWIKRNPKGSICSEGIKSF-KAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEQ--EMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDIALARIRRFVGVEK........................................ 428
3 -80.6001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  18  3...LSDRLELVSASEIRKLFDIAAG------------KDVISLGIGEP-----------DFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKK--QNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGG-KPVEVPTYEEDEFRLNVDELKKYV------TDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASL---------DGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQM--YNATCPVTFIQYAAAKALKDERSWVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDT-----GLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEK-LEEAMDRMERVLKERK........................................ 387
4 -80.4004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  21  7.KRFNKNLNKIEVSMIRQFD-----------QSISDIPDVLKLTLGEP-----------DFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPD-NEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNL-VGAEVVEIDTR-SNDFVLTPEMLEEAILK---EGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY-----------LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQ--YLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVAQG----QDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMET-IKEAMKRLKEFMEQYAD....................................... 393
5 -80.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  16  6.AKFKKLGTDNAPGQEVRQSAAGLEALIRG---APIEGRPVDFSHGDVD---------AHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVD-ARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEG-EMVPVQLDDETRAGLDLTGLEEAF------KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAV--------DAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQA--IVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPKL-----AVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQD-HEAAVAAARRIVTLVERYRA....................................... 407
6 -78.5001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  18  1MRGLSRRVQAMKPSATVAVNAKALELRRQGVD-------LVALTAGEP-----------DFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRR--ENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGG-VVVEVETLPEEGFVPDPERVRRAI------TPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EHFSPGRV-----------APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPI-----APDEVRAAERLL-EAGVAVVPGTDFA--AFGHVRLSYATSEEN-LRKALERFARVLGR.......................................... 384
7 -78.4001xi9_A mol:protein length:406 putative transaminase  ali model follow..  24  6...ASKRALSV-EYAIRDVVLPARELEKKGIK-------VIRLNIGDPVK--------FDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKR--KNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKF-YGGKPVEYRTIEEEDWQPDIDDIRKKI------TDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTKD----------VPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLA--RIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIEVG----PWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEI-LEEAMDRFEKFMKERLKE...................................... 400
8 -75.4004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  13  26...KSSKLENVCYDIRGPVLKEAKRLEEEGNK-------VLKLNIGNPAP--------FGFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQA--RGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSL-SSGKAVHYLCDESSDWFPDLDDIRAKI------TPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPD----------LLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAIEGLEMLASMRLCANVPAQHAIQTALGGYQSIFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDA--KRFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDD-IELSLSKFARFLSGYHQL...................................... 425
9 -74.4003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  20  1MSLKNSSRSAVDPFIVMDVMEAARRAEEAGRR-------IIHMEVGQP-----------GTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYG--VDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRA-LGLVPVDLPTAPENRLQPVPADF---------AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEA-KAVTALEL------------TDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQ--NMFICAPHASQVAALAALDCDAE-LQANLDVYKANRKLMLERLPKAGTRIAPPDGAFYVYADVSDL-----TDDSRAFAAEILEKAGVAVTPGLDFDPEGAGTLRFSYARATAD-IEEGLDRLEAFMQARGE....................................... 384
10 -74.3002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  18  7MDVFSDRVLLTEESPIRKLVPFAEMAKKRGVR-------IHHLNIGQP-----------DLKTPEVFFER-IYENKPEVVYYSHSAGIWELREAFASYYKRRQR--VDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKI-AGVKLIPVTRRMEEGFAIP-QNLESFI------NERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRG-EFASALSIE-----------SDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLA--QGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELPV-------EDAEEFARWMLTDFNTMVAPLRGFYLTGKKEIRIACVLEKDL-LSRAIDVLMEGLKMFCSSRIS................................... 402
11 -74.3001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  16  3...LAARVESVSPSMTLIIDAKAKAMKAEGID-------VCSFSAGEP-----------DFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQR--DNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEG-TPVILPTTVETQFKVSPEQIRQAI------TPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAA--------SPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQG--HSTSNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAKT-----GRSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDT-IKRGMERLEKFLHGI......................................... 387
12 -74.2001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  22  7..MVSRRISEIPISKTMELDAKAKALIKKGED-------VINLTAGEP-----------DFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGE--RYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGG-TVNVVETFMSKNFQPSLEEVEGLL------VGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTD-EFTSILDV---------SEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQS--HTTSCINTVAQYAALKALEVDNSYM---VQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRG--------DDVKFCERLLEEKKVALVPGSAFL--KPGFVRLSFATSIER-LTEALDRIEDFLNS.......................................... 382
13 -73.7002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  20  15..MISNKLANIPDSYFGKTMGRKIE---------HGPLPLINMAVGIP-----------DGPTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQRQYN--VTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLL-ADGKPVPLNLE-PPHYLPDWSKVDSQIID------KTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDA-KNPSILAS---------ENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQT--HTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPGY------DSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLA-LDDQKLDEAAIRLTELAYLYE........................................ 398
14 -73.6003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  16  29..FTSNTAKDVWSLTNEAAAKAANNSKNQGRE-------LINLGQGFF-----------SYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYN--TELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIEL-CGGKVVYVPINRGEEWTIDFEQFEKAI------TSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLS---------PEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAELLSYAAKAHT-RICFASPSPLQEACANSINDALKYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKVKIPEDYGKDFRISHWLINELGVVAIPPTEFYIKEENLLRFAVC-KDDAYLENAVERLKLLKDYL......................................... 447
15 -73.5002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  21  1..MLSKRLLNFESFEVMDILALAQKLESEGKK-------VIHLEIGEP-----------DFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYK--ADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVF---------CDFTVESLEEAL------SDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEG-KCYSAIEF---------DENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQ--NLFISAPTISQYAALKAFE-TEREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIG--------EDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYEN-IKEGLERIKEFLNK.......................................... 370
16 -73.4005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  17  2...NAKRIEGLDSNVWVEFTKLAAD------------PSVVNLGQGFP-----------DISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPN-EEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRM-AGAVPVFIPLRSKSDWTFDPRELESKF------SSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATL---------PGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNFYTCATPLQAALAEAFWIMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSL-MNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKEKLVRFCFIKK-DSTLDAAEEIFRAW............................................. 410
17 -73.4001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  18  15...LPKRYQGSTKSVWVEYIQLAAQY------------KPLNLGQGFP-----------DYHAPKYALNALAAAANSPANQYTRGFGHPRLVQALSKLYSQLVD--RTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKA-AGGIPRFIPLKSSADWVLDNNELEALF------NEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTL---------PGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNVYTCATPIQEAIAVGFETLKSPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSLDQETDARKDYRFTKWMTKSVGLQGIPPSAFYSEPEDFVRYCFF-KKDENLQKAAEILRKWKGS.......................................... 428
18 -73.0003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  39...RNENFGKLRAGYLFPEIARRRKAHQ----EKNPDAKIISLGIGDT-----------TEPLPKYIADAAGLATREGYSGYGAEQGQGALREAVASTFYGHAG----RAADEIFISDGSKCDIARIQ-MMFGSKPTVAVQDPSYPVYVDTSVM-MGMTGDHNGTGFDGIEYMVCNP-DNHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEI---------PGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEPVHMTTCFNGASNIVQAGGLACLQ-GLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGK-------PSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSREN-ILEAVRRFKEAYGKRNAS...................................... 443
19 -72.6005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  17  72...LSPRVQSLKPSKTMVITDLAATLVQSGVP-------VIRLAAGEP-----------DFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKE--ENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADA-TPVVIPTKISNNFLLDPKDLESKL------TEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASL---------PDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSASSIAQKAGVAALGLGKAGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSAYYGSEAINDSSSLALYFLDKFQVAMVPGDAFG--DDSCIRISYATSLDV-LQAAVEKIRKALEPLRATVSV................................... 475
20 -72.4001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  18  8...PQSKLPQLGTTIFTQMSALAQQ------------HQAINLSQGFP-----------DFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDAD-SDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIAL-SGGIVKRMALQ-PPHFRVDWQEFAALL------SERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAH---------PQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQ--YLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAV----STLDDVEFCQWLTQEHGVAAIPLSVFCADPHKLIRLCFAKK-ESTLLAAAERLRQL............................................. 386
21 -72.3005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  19  1MTDRVALRAGVPPFYVMDVWLAAAERQRTHGD-------LVNLSAGQP-----------SAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHG--ITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSA-LGCEVVEIPCGPQTRFQPTAQMLAEI-------DPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA-----------WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTG--NFTICPPVLSQIAAVSAFT-ATAEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDF-----TSDSLAFCSKLLADTGVAIAPGIDFDTAGGSFVRISFAGPSGD-IEEALRRIGSWLPS.......................................... 387
22 -72.2004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  18  4.QLQARRLDGIDYNPWVEFVKLASE------------HDVVNLGQGFP-----------DFPPPDFAVEAFQHAVSGDLNQYTKTFGYPPLTKILASFFGELLG--QEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMM-AGGRPVFVSLKSSSNWQLDPMELAGKF------TSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASL---------PGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNVFHCPTQSQAAVAESFERFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDF-GAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPDHYIRFCFV-KDEATLQAMDEKLRKWKVELENLYFQGKGGRAD............................ 435
23 -72.1002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  17  3...TVSRLRPYATTVFAEMSALATR------------IGAVNLGQGFP-----------DEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFG--VDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAV------TPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGF---------DGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQ--YLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPL----GYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFC-KRDDTLDEAIRRLSVLAERPATGVP.................................... 401
24 -72.0003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  14  15VDNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTQPGS-DEILYCNIGNPQLQREEIKTLFSADSISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIAS--RDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGG-ALVPYYLNESTGWGLETSDVKKQLEDARSRGINVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKFHSFKKIVRS--LGYGEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILADESYASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQICLPQKAANKAPDAFYALRLLESTGIVVVPGSGFGVPGTWHFRCTILP-QEDKIPAVISRFTVFHEAFMSE...................................... 487
25 -71.6002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  15  10...RFARIDRLPPYVFNITAELKMAARRRGED-------IIDLSMGNP-----------DGPTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRDRYD--VQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVI-AGAQVRSVPLVPGIDFFNELERAIRESIP------KPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQV---------PGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKS--YHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEPYAH---LGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALI-ENRDRLRQAVRGIKAMFRADGLLSPQRKVDSLAE........................... 412
26 -71.6001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  16  4WDVSMSNHAGLVFNPIRTVSDNAK--------PSPSPKPIIKLSVGDP-----------TLDKNLLTSAAQIKKLKEAINGYFPTVGSPEAREAVATWWRNSFELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKA-YGIGMHFYNCRPENDWEADLDEIRRLKDD------KTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDFTSVADFETT----------VPRVILGGTAKNLVVPGWRLGWLLYVDPHFLEGLKRVGM-LVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDLEK--RDIKTDVEFFEKLLEEENVQVLPGTIFHA--PGFTRLTTTR-PVEVYREAVERIKAFCQRHAAV...................................... 416
27 -71.4001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  20  3...LHPRTEAAKESIFPRMSGLAQR------------LGAVNLGQGFP-----------SNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEFA--------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPEGFRLDLSALEKAL------TPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGE-RPRRLREF-----------APERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG-----------WDAFRLVEEARVALIPASAFYLEDKDLFRFAFCKT-EEELHLALERLGRVVNSPREAEGGAVS................................ 380
28 -69.3002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  14  23KVSRNSNMSKLQAGYLFPEI----ARRRSAHLLKYPDAQVISLGIGDTTEPIP------EVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLG----IGDDDVFVSDGAKCDISRLQ-VMFGSNVTIAVQDPSYPAYVDSSVI-MGQTGQFNTDVQKYGNIEYMRCTENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNP-RSIFEI---------PGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGFPVAICTCFNGASNISQAGALACLT-GLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPN-------QSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHREN-ILEACRRFKQLYK........................................... 426
29 -69.0006DK6 Entity 1(prereleased)  ali follow..  16  7.NFLKLKAGYLFPEIARRVKAFTEGNPEAAQR-------LIRCGIGDV-----------TEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARG--LPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVM-IGNTGEADENGAYAGLVYLKCTPENGFVP-DIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEI---------EGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQFNGASYIVQKGAEALYTDEG--KSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGL------TSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRAN-VEEVCRRIAAL............................................. 410
30 -68.6004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  17  28....WTSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPTV---------NLKTPDIVTEAMVDVVRSGFNGYPPTVGADNLRQVVSTYWRRFCQRQEALKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDS-YGIECRYYYLDPSKSWECDLRAAAGMVDS------HTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTN----------VPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLTQLIAGVNSICQEAIARTL--LKCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNLSY--QDLKSDMEFYEKLLDEENVQVLPGEIFGM--SGFLRATVS-RPSAVLNEAVDRIIEFCERHKK....................................... 438
31 -68.4003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  17  19LESMNPQVKAVEYAVRGPIVLKAGEIELELQRGIKKPTEVIRANIGDAQAMGQQPITFFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRR-DGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISEL-DAIQVNYYLDEENCWALNVNELRRAVQEAKD-HCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCFHSFKKVLYE--MGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINL-HPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFENLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFIPAKAHQMAPDMFYCMKLLEETGICVVPGSGFGQRETYHFRMTILP-PVEKLKTVLQKVKDFHINFLEK...................................... 490
32 -68.0003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  16  19.SVRPSDMAKKTFNPIRAIVDNMKVKPNPNKT-------MISLSIGDPTVFGN-------LPTDPEVTQAMKDALDSGYNGYAPSIGFLSSREEIASYYHC---PEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAES-MGIEVKLYNLLPEKSWEIDLKQLEYLIDE------KTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTD----------VPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLQRILGPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIEMEH--PEFENDVEFTERLVAEQSVHCLPATCFEY--PNFIRVVIT-VPEVMMLEACSRIQEFCEQHYHC...................................... 421
33 -67.6003jtx_A mol:protein length:396 aminotransferase  ali model follow..  15  2...MNTLLKQLKPYPFARLHEAMQGISAP------EGMEAVPLHIGEP-----------KHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLL-GGGEIHFANC-PAPSFNPDWRSISEEVWK------RTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQ------GRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSMSIPVQRASIAAWDD----EQHVIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPD-------GDDLAFARNLWQKAAIQVLPGRFLGNPGEGYVRIALVA-DVATCVKAAEDIVSLYR........................................... 396
34 -67.4002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  17  2.......SRVPEPSVFLVVDEAKRKARERGVG-------LIDLSIGST-----------DLPPPEAPLKALAEALNDPTTYYCLKSCTLPFLEEAARWYEGRYG--VGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASL---RTFLIPLREDGLADLKAVPEGVWR------EAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEG-EAPSPLAL---------PGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKG--VIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPEGV------DDLEFGLRLV-ERGVALAPGRGFGPGGKGFVRIALVR-PLEELLEAAKRIREALD........................................... 376
35 -67.1003ele_A mol:protein length:398 Amino Transferase  ali model follow..  18  3..VVNESMYQLGSVRSAI---RELFEYGKKRAAIVGKENVYDFSIGNP-----------SIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHG--THFNADNLYMTMGAAASLSICFRALTDAYDEFITIAPYFPEYKVFVNA-AGARLVEVPAD-TEHFQIDFDALEERI------NAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVTKY------------YDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRALGYVCAPSLFQKMIVKCQGATGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKALE-------DDSNAFCEKAK-EEDVLIVAADGFGC--PGWVRISYCVDREM-IKHSMPAFEKIYKKYNK....................................... 398
36 -67.0003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  16  2.NVRPSDMSNKTFNPIRAIVDNMKVKPNPNKT-------VISLSIGDPTVFGN-------LPTDPEVTQAMKDALDSGYNGYAPSIGYLSSREEVASYYHC---PEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAES-MGIEVKLYNLLPEKSWEIDLKQLESLIDE------KTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATL----------STNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLQRILGPCTIVQGALKSILQTPQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIEMEH--PEFENDVEFTERLIAEQSVHCLPATCFEY--PNFFRVVIT-VPEVMMLEACSRIQEFCEQ.......................................... 400
37 -67.0003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  16  3...RNPHFVSLTKNYLFADL----QKRVAQFRLENPQHTVINLSIGDT-----------TQPLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRGF-----VDAKEIFISDGAKVDLFRLL-SFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENAFFPEFP-----------EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEI---------PDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGHFV-LSTTFNGASIPAQEAGVAGLSILPQ--LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQ-----ANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKRED-ILAACERLQMAPALQS........................................ 394
38 -66.2004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  14  39..VRNVNLEKLKNNYLFPEI----NRRELEHIEKHPNVQLISLGTGDT-----------TEPIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYRDLH----VKSNEVFVSDGAQSDISRLQ-LLLGSNVTIAVQDPTFPAYIDSSVI-IGQTGHFHEKTKKYQNVVYMPCGNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSP-RSIYEI---------PGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELLYSNGFPIIVTTSFNGASNIAQAGGLACLS-GLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGS-------KSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDH-IVEASKRLQNFFNTRTKHFTYLSSTSNTN........................... 456
39 -66.0003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  13  14.KQNELHIKDLGMASIRDLVALVTNLEK------ATGTKFCRMEMGVP-----------GLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVN--IDIPARACVPTVGSMQGCFVSFLVANNREYGTLFIDPGFNLNKLQCRIL-GQKFESFDLFEYRGEKLREKLESYL------QTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSHPGEPL----YQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLALSSGATHSAQWGMAAMLKACNDGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVEPLADGFYFTVGYKGM------DSSKLIEKFVRYGMCAITLK-TTGSKRNEAMRICTSLLPESQFPDLEKRLQMLNAE.......................................... 436
40 -65.8004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  15  14.HMSSLRPRREDPPVLEEWYRRHLG---------PDIHDISSSGVHP-----------YSFAEIRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAG-------GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAA-GCDVAVLPGRAVRDGEIDPDVLAGLV------TPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPGAD------------GGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDR--TTLFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFRELERAAGPQEVERFCLELLERHRTLLVPGTAFG--APHGARLGFGGPQED-FRAGLDGLSRFLRERAAGR..................................... 400
41 -65.5003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  16  13...........................RALLKEITPKKRGLDLGIGEP-----------QFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRRFK--IELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKF-IKAKSLLMPLTKENDFTPSLN---------EKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPP-PSLLEACML----AGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYSANAIQKASEAAWLD----DRHAEFFRNIYANNLKLARKIFKN----TLIYPYSFYVYLPVQ---------NGENFAKTLYQNEGIITLPALYLGRNRIGYVRLALVY-DTPLLEKPLEIIETYRENHA........................................ 376
42 -65.1003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  16  77....YINTDGIRERLFAFLDPDKNDEDKFLID-------AVNYCHTEL-----------GLNRDKVVAEWVNGAVANN--YPVPDRCLVNTEKIINYFLQELYKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYLVEVDLHSYEKNDWEIEPNEIEKLK------DPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVV--------------PYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSKFIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYRLAEKTNNFEQVDFLLKLAEKNGVVLVDGVGFGAKP-GELRVSQANLPTEDYALIGKQVLELLKEYYEEFKQNN................................. 533
43 -62.9003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  20  9...................VEEWLNVHENSAIYDIAGVSISSLTLEEL------------FALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTG-------VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSL-GAEVDLWQIEEENGWLPDLEKLRQLI------RPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVPSII--------------EVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDY--TMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIA------VDMPMEDFCLQLLQEHGVLLVPGNRFE--RDGYVRLGFACEQET-LIKGLEKLSQFLRRFDKEN..................................... 375
44 -61.8003if2_A mol:protein length:444 Aminotransferase  ali model follow..  16  2MK-FSKFGQKFTQP------TGISQLMDDLGDALKSDQPVNMLGGGNPAKVNELFLETYKALGNDNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYD--WNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVEVTHDGEEGFFKYRVDFEALENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLNW------------DNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLPTRFGAAIATPLVANDRIKQLSDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKDL------ISTLDLYERLKAK-GTLIVPSEYFFPGAHECIRMSIAA-DEQTLIDGIKVIGEVVRELYDNK..................................... 444
45 -60.4006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  12  12GSHMHPQATPAPGAPLLDLTQHEIQALTMKYN-------LADAHTHQR-----------QSASQQSIVSRLPQLWYEA-EEGLQATYEKRFTEAFFQLHRQ----PTALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMD---VPLYPIDESVFYDVDRIYPELE------RRVRTDALFLVDPNNPTGFSHGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMY------ELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLVSPFVLNMLTQYVRDSA--ADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVWFRVDH------PELTATDVHRLLSADGVYVLPGRYFPSKGDAYVRMALA-REPEMFADAMALTRQVLDRHGR....................................... 407
46 -59.5005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  15  10...............................NLTQWAYLALNSELNIA-----------DGHARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQH---GYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGN-GLDLVPVEEDALHGADLS-----------AELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAA-HYDHYAVL---------QEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFS-RDAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVE--------AFAGRTGTEVWE-ELQRHHVFALPCRQFHWAEPHMVRIALS-RSTEPLEKSVQVLRTVLET.......................................... 375
47 -59.3003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  17  2MTFSLFGDKFTRHSGITRLMEDLNDGLRT--------PGAIMLGGGNPA---------HIPAMQDYFQTLLTDMVESGLCNYDGPQGKTALLNALAVLLRETLG--WDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFNIELLPEGQFKYHVDFEHLHIGE------ETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYG-VPFPGIIFSEARPLWN-----------PNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLPGGMGPAMMCEMIKRNDLLRLSETVIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDL------PITTELLYQRLKARGVLMVPGHYFFPGTHQCMRMNYVPEPDK-IEAGVKILAEEIERAWREG..................................... 417
48 -58.5002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  16  68.YMTVGVGGLAKLDGIEGRFERF-IAEHRDQEGVKFLGKSLSYVRDQL-----------GLDPAAFLHEMVDGILG---CNYPVPPRMLTVSEQIVRQYREMAGGAVPPESVDLFAVEGGTAAMAYIFSGLLKAGDKVAIGMPVFTPYIEIPELAQYLKEVPIHADPDNGWQYSDAELDKLK------DPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVC--------------PRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRVQQSSTGDMLFRVADETGIVLLPGRGFGSDR-PSGRASLANLNEY-EYAAIGRALRRLADELYEQYKALGKEKLAAA......................... 536
49 -58.0002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  12  10...LNEQLQQSNATAFAMLSDLGQNMFYPK-QSAEAKSTTYNATIGM-------ATNKDGKMFASSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNPELSIDNMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPI--DKDGHYTTDSLVEALQSYNK---DKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFTALTN------HSNAILPIRLDGATKEFFAWGFRVGFMTTTKEVLEAKVKGLSNISSGPLPTQSAVKHVLKNNK-IEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHD-------VDPEALRKHLIDKYSIGVIALNATD------IRIAFSCVEKDDIPHVFDSIAKAIDDLR........................................ 430
50 -57.3002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  14  91........................IAENRDQEGVRFLGKSLSYVRDQL-----------GLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGDAIPSESVNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYLEEVAINADPSLNWQYPDSELDKLK------DPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAIC--------------PENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKL--QESEKVALDHRYRSLLPDVRSLKFIDHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKVKQSSTGDMLFRIADETGIVLLPGRGFGSNR-PSGRASLANLNEY-EYAAIGRALRKMADELYAEYSGQAQNLKLAAALE...................... 540
51 -56.8003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  14  68YMNTVGVGGLAKIEGIEGRFERY-IAENRDQEGVRFLGKSLSYVRDQL-----------GLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGDAIPSESVNLFAVEGGTAAMAYIVNGLLKAGDKVAIGMPVFTPYIEIPELAQYLEEVAINADPALNWQYPDSELDKLK------DPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFAIC--------------PANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRL--PESEKTALDDRYRSLLPDVRSLKFLDHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDVTSKVKQSSTGDMLFRIADETGIVLLPGRGFGSDR-PSGRASLANLNEY-EYAAIGRLRQMADELYAQYTQQGNKR.............................. 533
52 -53.6004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  15  8...IKRATWNNGPDLAFDINNKANAAIEK-----YGREAVINAALGTLL------DDKGKIIALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTL---FGPYKPEGYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEE-FGRNFKTFEFFTDDF-AFNIDVYKEAIDEGIRDSDRIASLINSPGNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNL------PRNLFVVVAFSMSKSHTAYGLRSGAAVSSKEIIEEFEASLAHSASNGTHAAQNILIELERAENKKIYLVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPT----------DKAFDIVKDLEKENIFTIPSAKGI-------RVAICGVGEEKIPKLVQRLAFYTNK.......................................... 412
53 -52.9003b1c_A mol:protein length:392 BetaC-S lyase  ali model follow..  16  17.......................LSHHTYKWKETETDPQLLPAWIAD-----------MDFEVMPEVKQAIHDYAEQLVYGYTYAS--DELLQAVLDWEKSEHQ---SFDKEDIVFVEGVVPAISIAIQAFTKEGEAVLINSPVYPPFARSVRLNNRKLVSNSLKEENGLFQIDFEQLENDIVE-----NDVKLYLLCNPHNPGGRVWEREVLEQIGHLCQKHHVILVSDEIHQDLTLFGHEHVSFNTV--------SPDFKDFALVLSSATKTFNIAGTKNSYAIIENPTLCAQFKHQQLVNNHHEVSSLGYIATETAYRYGKPWLVALKAVLEENIQFAVEYFAQERLKVMKPQGTYLIWLDFSDY-----GLTDDALFTLLHDQAKVILNRGSDYGSEGELHARLNIAA-PKSLVEEICKRIVCCLPK.......................................... 392
54 -52.9003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  15  8..AAKHAKGKKLKDVIFVTAGQAQADAKE-----NGRENVVNGTLGA------IHDEEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKEC---FGNFRPEGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSD-TGRTLVTYSL--DEHNNFNHEAFQNRVNELAAKQTN-VVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKF------SHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVWSNICRPAMRTMANIVADPAKFKEYRNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD---------SANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEK-IYNAMKSLGKL............................................. 418
55 -52.8003dzz_A mol:protein length:391 putative pyridoxal 5`-phosphate-dependent C-S lyase  ali model follow..  18  26....................................KEKELPMWIAE-----------MDFKIAPEIMASMEEKLKVAAFGYESVP--AEYYKAVADWEEIEHR---RPKEDWCVFASGVVPAISAMVRQFTSPGDQILVQEPVYNMFYSVIEGNGRRVISSDLIYENSKYSVNWADLEEKLAT-----PSVRMMVFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDITPAFTV--------DWDAKNWVVSLISPSKTFNLAALHAACAIIPNPDLRARAEESFFLAGIGEPNLLAIPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKPEVKVLDSNASYLAWVDISAL-----GMNAEDFCKYLREKTGLIISAGNGYRGNGHEFVRINLAC-PKELVIDGMQRLKQGVLNLNN....................................... 391
56 -52.7001d2f_A mol:protein length:390 MALY PROTEIN  ali model follow..  16  11....................HGTWCTQWDYVADRFGTADLLPFTISD-----------MDFATAPCIIEALNQRLMHGVFGYSRWKN-DEFLAAIAHWFSTQHY---AIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAK-----PECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVAR-----------GDWALLTSGSKSFNIPALTGAYGIIENSSSRDAYSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAELNWQIPQSTYLAWLDLRPL-----NIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGC-PRSKLEKGVAGLINAIRAVR........................................ 390
57 -52.7003l8a_A mol:protein length:421 Putative aminotransferase, probable beta-cystathionase  ali model follow..  16  41.......................LNQFTYKWKTSENNPELLQMWVAD-----------MDFLPVPEIKEAIINYGREHIFGYNYFN--DDLYQAVIDWERKEHD---AVVKEDILFIDGVVPAISIALQAFSEKGDAVLINSPVYYPFARTIRLNDHRLVENSLQIINGRFEIDFEQLEKDIID-----NNVKIYLLCSPHNPGGRVWDNDDLIKIAELCKKHGVILVSDEIHQDLALFGNTHHSLNTL--------DASYKDFTIILSSATKTFNIAGTKNSFAIIQNESLRRKFQYRQLANNQHEVPTVGMIATQAAFQYGKPWLEELKTVIEGNIKLVIKELEAKKIKVMEPEGTYLVWLDFSAY-----AIAQPQLSEKLQNEAKVVLNDGAHFGKEGKYFARLNVAT-PKNTVQEALSRIISVFGK.......................................... 415
58 -52.7001c7n_A mol:protein length:399 CYSTALYSIN  ali model follow..  16  28..................................EVGNEVVPLSVAD-----------MEFKNPPELIEGLKKYLDETVLGYTGPT--EEYKKTVKKWMKDRHQ---DIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELLEKDGYYTIDFQKLEKLSKD-----KNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHTVFQSI--------DEQLADKTITFTAPSKTFNIAGMGMSNIIIKNPDIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVPEIKAPLIEGTYLQWIDFRAL-----KMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAA-PSSVIQESLERLNKALKDLKNRH..................................... 397
59 -52.6003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  16  22...................................KNEELIHAWIAD-----------MDFEVPQPIQTALKKRIEHPIFGYTLPP--ENIGDIICNWTKKQYN---DIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQ------GVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASL--------SEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHTLSVMKPEGSFLLWIDCSAL-----NLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGC-PRSVLEEILNRLRHTFS........................................... 383
60 -52.3001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  17  17.SFFSEKAMLMKASEVRELLK------------LVETSDVISLAGGLPA------PETFPVETIKKIAVEVLEEHADKALQYGTTKGFTPLRLALARWMEKRYD--IPMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYY-DPEFISIPLDDKG---MRVDLLEEKLEELRKQGKRVKIVTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHFDDY----------GRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVENGYLDEHIPKIIEFYKPRRDAMLEALEEYGVEWTKPEGGMFVRVTLPEGI------DTKLMMERAVAK-GVAYVPGEAFFVHRDKTMRLNFTYVPEETIREGVRRLAETIKEEMKRVK.................................... 416
61 -52.3002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  17  5.KYLAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPELIPRAVLGEIAKEVLEKE--------------PKSVMYTPANGIPELREELAAFLKKYDH--LEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQL-GAKIEGVPVDNDG---MRVDLLEEKIKELKAKGQKVKLITIPTGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDNE----------GRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFAPAISQYIALEYLKRGYFEKYHLEGALLGYKEKRDIMLKALENHNAEFTKPIAGMFVMFFLPEGA------DGISFANELMEREGVVVVPGKPFYTDESGAIRLNFSRPSKEEIPIGIKKLAKLYKEKFGE...................................... 407
62 -52.2004dgt_A mol:protein length:391 Putative pyridoxal phosphate-dependent transferase  ali model follow..  16  15....................SNNFSSKWSEMEKKYGTNDLLPMWVAD-----------MDFKAAPCIIDSLKNRLEQEIYGYTTRP--DSYNESIVNWLYRRHN---KIKSEWLIYSPGVIPAISLLINELTKANDKIMIQEPVYSPFNSVVKNNNRLIISPLQKLENGNYIMDYEDIENKIKD-------VKLFILCNPHNPVGRVWTKDELKKLGDICLKHNVKIISDEIHSDIILKKHKHIPMASI--------SKEFEKNTITCMAPTKTFNIAGLQSSYVVLPDEKDYKLLDDAFTRIDIKRNNCFSLVATEASYNNGESWLESFLEYLESNIDFAIKYINENKLKVRKPEGTYLLWVDFSAL-----GLSDEELESILVQKGKVALNQGNSFGIGGSGYQRINLAC-PRSMLEEALIRIKNAIN........................................... 391
63 -51.7003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  17  22....................................GQGVLPLWVAE-----------SDFSTCPAVLQAITDAVQREAFGYQPDG--SLLSQATAEFYADRYG---QARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGI-----FIDATGGINLHDVEKGFQA------GARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDG-QHTVAAGV--------SDTAASVCITITAPSKAWNIAGLKCAQIIFSNPSDAEHWQQLSP-VIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRGAKITPMQATYLMWIDFRDT--------EGSPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFAT-SREVLEEAIDRMAKAVSHHT........................................ 377
64 -51.3001vp4_A mol:protein length:425 aminotransferase, putative  ali model follow..  15  13.GKISKIGQNMKSSIIREILK------------FAADKDAISFGGGVPD------PETFPRKELAEIAKEIIEKEYHYTLQYSTTEGDPVLKQQILKLLERM-YGITGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQY-LANFVVVPLEDDG---MDLNVLERKLSEFDKNGKIKQVFIYVVSHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKIGGP----------ERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLLEQLKPTIELYRRKRTVMLNALEEYGVKWVKSEGGLFIWLTLPEGF------DTWEMFEYAKRK-KVFYVPGRVFKVYDEPSMRLSFCLPPDEKIVEGIKRLREVVLEYGKEKHL................................... 418
65 -51.1003ue8_A mol:protein length:439 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  15  5.RFITAASAARNPSPIRTMTDILSR----------GPKSMISLAGGLPN------FKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPL-GCNIINVASDESG---IVPDSLRDILSRWKPEDAKNPQFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVD----------GRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLPSTFNQLMISQLLHEEEGFMAHVDRVIDFYSNQKDAILAAADKWLAEWHVPAAGMFLWIKVKGIN------DVKELIEEKAVKMGVLMLPGNAFYVDSSAYLRASFSSASPEQMDVAFQVLAQLIKESLLVPRGS.................................. 431
66 -50.7006d0a_A mol:protein length:431 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  15  5.RFITAASAARNPSPIRTMTDILSR----------GPKSMISLAGGLPN------FKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPL-GCNIINVASDESG---IVPDSLRDILSRWKPEDAKNPQFLYTVPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVD----------GRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLPSTFNQLMISQLLHEEEGFMAHVDRVIDFYSNQKDAILAAADKWLAEWHVPAAGMFLWIKVKGIN------DVKELIEEKAVKMGVLMLPGNAFYVDSSAYLRASFSSASPEQMDVAFQVLAQLIKE.......................................... 423
67 -50.0003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  12  1...MFQKVDAYAGDPILTLMERFKEDPR---------SDKVNLSIG----LYYNEDGIIPQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLYFPESGVWVSDPTWENHVAIFAG-AGFEVSTYPWYDEATNGVRFNDLLATLKTLQA---GSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIAS--------AGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNQRGMFSYTGLSAAQ--VDRLREEFGVYLIASG----------RMCVAGLNTANVQRVAKAFAAVM............................................ 397
68 -49.7003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  14  1...MFENITAAPADPILGLADLFRADER---------PGKINLGQGVYK------DETGKTPVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFG--KGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNS-AGLEVREYAYYDAENHTLDFDALINSLNEAQA---GDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAF--------AAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQYSNPPAHGASVVATILSNDALRAIWLTDMRQRIQRMRQLFVNTLQEKGANFIIKQNGMFSFSGLTK-----------EQVLRLREEFGVYAVASG----------RVNVAGMTPDNMAPLCEAIVAVL............................................ 396
69 -49.3004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  11  3...MFEHIDAYPGDPILTLNENFQKDPRD---------QKVNLSIGIYF------AEGRIPVMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFG--ADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFER-AGFTVNTYPYYDEATGGLKFDAMLAAIDALPA---RSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRELAR--------RGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGASNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKQRGMFTYTGLTESQ--VDALREVHGVYILRSG----------RMCVAGLNDSNVGIVADAIGKVLKSGA........................................ 402
70 -48.8001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  13  40.....................ECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASA------LVSPWHRMSYFFNPVSNFIFELEKTIKELHEVVGN--AAAKDRYIVFGVGVTQLIHGLVISL-SPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNP------EQYIEMVTSPNNPEGLLRHAVI----------KGCKSIYDMVYYWPHYTPIKYKA-----------------DEDILLFTMSKFTGHSGSRFGWALIKDESVYNNLLNYMTKNTEPRETQLRSLKVLKEKGTMRDLNTFGFKKLRERWVNITALLDQSDFSYQELPQSEYCNYFRRSYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFEASS-RYVRLSLIKTQDD-FDQLMYYLKDMVKAKRKTPLIKQLFIDQTETASRR..................... 445
71 -48.7003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  13  17................................NIPMSDFVVNLDHGDP-----------TAYEEYWRKMGDRCTVTIDLMSYFSDMTEPELEDAIKDLHGVV--GNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRS------------------GMYKWEGDAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTP------------------TRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVEYIIVNSVSKESQVRTAKILNVLK--ENFFKYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYFGKSLESYPALGTKEETDLVSELRRHKVMSRAGERCGS-DKKHVRVSMLS-REDVFNVFLERLANMKLIKSI....................................... 389
72 -48.6001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  13  1...MLGNLKPQAPDKILALMGEFRADPR---------QGKIDLGVGVYK----------DATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGLKSETTA-TLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNF-MGLPVQTYRYFDAETRGVDFEGMKADLAAAKK---GDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIAS--------RIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEHRGMFSRLGATPEQ--VKRIKEEFGIYMVGDS----------RINIAGLNDNTIPILARAIIEVG............................................ 393
73 -48.4003ez1_A mol:protein length:423 Aminotransferase MocR family  ali model follow..  12  2...MTKEASRPALDLA-----------RQAYEAFKARGLNLNMQRGQPA---DADFDLSNGLLTVLGAEDVRMDGLDLRNYPGGVAGLPSARALFAGYLDVKAENNSSLELQGLVLTFALLHGVRGSTGPWLSQTPKMIVTVPGYDRHFLLLQTL-GFELLTVDMQSDG---PDVDAVERLAGT----DPSVKGIFVPTYSNPGGETISLEKARRLAGLAAAPDFTIFADDAYRVHHLVEEDRAEPVNFVV---LARDAGYPDRAFVFASTSKITF-AGAGLGFVASSEDNIRWLSKYLGAQSGPNKVEQARHVKFLTEYPGLEGLMRDHAAIIAPKFRAVDEVLRAE-ATWTLPKGGYFISLDTAEPVADRVVK--------LAEAAGVSLTPAGATYPAGQDNLRLAPTRPPVEEVRTAMQVVAACIRLATEEYRA................................... 421
74 -48.4004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  14  1MAVTFENITAAPADPILGLADLFRADER---------PGKINLGIGV----------YKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFG--KGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNS-AGLEVREYAYYDAENHTLDFDALINSLNEAQA---GDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAA--------MHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQYSNPPAHGASVVATILSNDALRAIWLTDMRQRIQRMRQLFVNTLQEKGANDFSFIIKQNGMFSFSGL--------TKEQVLRLREEFGVYAVASG----------RVNVAGMTPDNMAPLCEAIVAVL............................................ 400
75 -48.3003aov_A mol:protein length:448 Putative uncharacterized protein PH0207  ali model follow..  17  65................................KLVETSDIISLAGGLPN------PKTFPKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKR---YGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFY-EPQYIQIPLDDEG---MKVEILEEKLKELKSQGKKVKVVTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALDNE----------GRVIYLGTFSKILA-PGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEEFGVKWTKPEGGMFIWVTLPDGI------DSKKMLERAIKK-GVAYVPGEAFYAHRDVTMRLNFTYVDEDKIMEGIKRLAETIKEELKA...................................... 442

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.