current user: public

If you have questions about the server, please let us know.

Query: 2bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MTFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPELast
1 -72.7002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model  100  1MTFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE 123
2 -66.4004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  32  23.TPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH. 145
3 -65.7005d1v_A mol:protein length:127 Globin  ali model follow..  55  5.TIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLG 125
4 -65.3001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  58  4.SFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP. 127
5 -65.1002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  39  7.TLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEA 130
6 -64.8002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  44  5.TLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPD 125
7 -64.2005v3t_A mol:protein length:132 Globin  ali model follow..  39  7.TPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPN 127
8 -63.4004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  95  35.TFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE 156
9 -62.3004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  20  9.SLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGE 130
10 -61.7002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  16  14.SIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGES 131
11 -61.5006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  14  2.TLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERY 123
12 -61.4001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  17  14.SIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGES 131
13 -61.4003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  19  6.TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK.. 121
14 -61.1001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  20  1.SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT... 115
15 -61.0002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  15  2.SLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHDVLNR.. 123
16 -60.2001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  19  3.TLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ.. 124
17 -58.7001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  15  44.SLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQ 163
18 -57.4001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  41  7.APYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTE 126
19 -55.2004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  28  26.NLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAGNE 149
20 -54.5004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  24  52.KKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPTSEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRT 174
21 -45.2002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  15  1..MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNEEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIVYNE-EMKNVILQRAQMIASHFQNM.. 120
22 -17.0001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  18  20.............TGFFDDFYRHFASSPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYG 133
23 -15.4002w31_A mol:protein length:162 GLOBIN  ali model follow..  14  29.........ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI......... 138
24 -15.0001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  59.........QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI......... 168
25 -14.5004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  10  32.........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVDDVERL-QHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSID... 145
26 -14.1004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  13  27.........VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVDDVERL-QHTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS......... 138
27 -14.0004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  10  74.........TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSQALIAQ--QKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET......... 187
28 -13.5004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  16  32.........TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV......... 145
29 -13.3005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  16  34.........APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV......... 145
30 -12.9002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  11  50.........EDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA......... 177
31 -11.7001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  10  19.........KANIPQYSVVFYTSIEKAPAAKDLFTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK... 142
32 -11.6003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  14  17.........IDKMDEAGLLFYRRLFDEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE.. 132
33 -11.3003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  10  18.........EPNKNEIGLLFYANLKEEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE.. 133
34 -11.2002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  11  17.........QKNGEDLTNEFYKIMNDYPEVKPMFNKQISGEQPKALAMAILMAAKNIENLEN----DKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEK 135
35 -10.7001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  12  18.........KEHGVTITTTFYKNLAKHPEVRPLFDRQESLEQPKALAMTVLAAAQNIENLPA----KKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVEA 138
36 -10.1001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  12.STWKDIAGADNGAGVGKECLSKFSAHPEMAAVFSDPGVAELGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQ 146
37 -9.8701gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  19.........NANIPKHTHRFFILVEIAPAAKDLFSNPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMD 150
38 -9.7301jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  12.STWKDIAGSDNGAGVGKECFTKFSAHHDMAAVFSDPGVADLGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQ 146
39 -9.3201hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  12.ATWKDIAGADNGAGVGKKCLIKFSAHPQMAAVFSDPGVAALGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAQYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQ 146
40 -9.2501eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  11  21................VGILYAVFKADPSIMAKFTTAPFETHANRIVGFFSKIIGELPNIEAD---NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK.. 135
41 -9.1801kr7_A mol:protein length:110 Neural globin  ali model follow..  11  2..........VNWAAVVDDFYQELKAHPEYQNKFGFKGVAKGNAAYKTQAGKTVDYINAAIGGSADAALASRHKGRNVGSAEFHNAKACLAKACSAH-GAPDLGHAIDDILSHL......... 110
42 -9.0901hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  10  29.........MTHRTGFVADVFIRIHNDPTAQRKFPSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEGFTKQVHDAWAKTFAIVQGVLITKHA 158

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.