current user: public

If you have questions about the server, please let us know.

Query: 2cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MPGGVSSPVRAFKSVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKATTAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPVYQAGTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTIAAARTVLSQLLast
1 -107.0002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model  100  1MPGGVSSPVRAFKSVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKATTAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPVYQAGTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTIAAARTVLSQL 411
2 -106.0002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  81  22MPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMSAL 432
3 -105.0003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  61  18MPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQL-TPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIFFTDEPVINYDAAKSSNLQFFAAYYREMVEQGVFLPPSQFEGLFLSTVHSDADIEATIAAAEIAMSKL 427
4 -105.0003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  60  20MPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQL-TPDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMIGFFFTNEPVINYETAKASDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTIQAAEKVFAEI 429
5 -105.0005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  54  17IPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPTALEVEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVALGGAQAYYGVTPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAAGIPFVTTQAGGMFGLYFSGAAIVTFEDVMASDVERFKRFFHLMLDGGVYLAPSAFEAGFTSIAHGDKELEITLNAAEKAFAAL 428
6 -104.0005hdm_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic  ali model follow..  73  24MPGGVNSPVRAFKSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTNKEKFIKFEGCYHGHANAFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDLEAVEKLFAAHKGEISAVILEPVVGNSGFIPPTPEFINGLRQLTKDNGVLLIFDEVMTGFRLAYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKQAGTYEYLDKITKELTNGILEAGKKTGHPMCGGYISGMFGFFFAEGPVYNFADSKKSDTEKFGRFFRGMLEEGVYFAPSQFEAGFTSLAHTPEDIQLTIAAAERVLSRI 434
7 -104.0002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  53  17IPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEPVVGNAGVLVPTEDFLKALHE-AKAYGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKILGGGLPAAAYAGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEEPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEGPVVTFQDARRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHREEDVEKTLEALRKAL... 424
8 -103.0004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  56  18IPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFTNDTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL 429
9 -102.0003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  48  19IVGGVNSPSRSFKAVGGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAAL 430
10 -102.0002epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  42  23FPGGVNSPVRAAVK--PYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAVEGLRSSLKTV 431
11 -100.0004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  37  36IAGGVSSSMRAA--AVPLPLVVRSAGGCLLRDVEDGEIIDLNMGYGPHLFGYADREVLDAVADQFAKGHMTGLPHELDARAGALIAELVPGVEQVRFANSGTEAVASALRLARATTGRTLVVTFEGHYHGWSETVLRAGKTALHMEGVPGALGMIPEALAHTVQLGWNDPDALRELFARDGDRIAAVIVEPVLANAGVIPPAPGFLQLLRELTGRSGAMLVFDEVITGFRVARGGAQERYGVEPDLTVLSKVMGGGFPVAAFGGRRHAMRMLAS-NEAHHAGVYAGNHAALRAVVAMLGKIRSPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMSVALLKGSAEPSAEAALVDFPRHRRLQTLAQKEGVYFHPNALEPWFLSTAHTRDVIDKVAGALQRSLVGL 457
12 -98.7002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  32  25MPDGVTADTRAFDP---HGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRFEGHYHGWHDFSASGYNS---HFDGQPAPGVLPETTANTLLIRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGRKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPGSITRAEVARPDVKMIAAMRMALILEGVDIGGRG--SVFLSAQHEREHVEHLVTTFDRVLDRL 435
13 -98.6006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  30  25MPDGVTADTRVFDP---HGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRIATHYHGWHDFSASGYNS---HFDGQPAPGVLPEIAKNTLLIRPDDIEGMREVFAQHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGRKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPGSITRAEVARPDVKMIAAMRMALILEGVDIGGRG--SVFLSAQHEREHVEHLVTTFDRVLDRL 435
14 -98.0005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  34  30LPGGNTRTTVYSAP---YPPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLADGVAFAMPTEHEIALAELLTERVPSLQQVRFTNSGTEAVMMAIKAARAYTGRPRIAKFDGCYHGSYDFAEVSTGEDGFPVATPYTGGTPQAVLDSVVVLPFNDIDGTERLIEQHRDELAAVLIDPNPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVIS-LRSDYGGMQSVLGVTPDLTAMGKIIGGGFPVGAVGGSAEVMSVFDPTGRAPHGGTFNANPVTMVAGLTAMRKL-TPAEFDRLATLGQQLRAGVEEVLREAGVPGQVTGYGSLFHIHLHQRPLADYRNSVLSERAFVGRVHEALMGRGIFITPALF--GCLSTPMGVPEVEAFVDAFAAALQDA 444
15 -96.8002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  33  62MPGGNTRSILFHRP---FPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQTENEALFAEAVCDRFPSIDLVRFTNSGTEANLMALATATAITGRKTVLAFDGGYHGGLLNFA--------------SGHAPTNAPYHVVLGVYNDVEGTADLLKRHGHDCAAILVEPMLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS-RLSGGGAQEMLGISADLTTLGKYIGGGMSFGAFGGRRDLMERFDPAGAFAHAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIAVENQAPLQFTGLGSLGTIHFSRAPIRSAGDVRAADQQLKELFFFHMLRKGIYLAPRGM--YALSLEIADAGRDAFAEALADFIGEQ 454
16 -94.6004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  35  49MPGANSRSVLFYAP---FPLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAALHFTGRRKIVVFSGGYHGGVLGFG--------------ARPSPTTVPFDFLVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS-RLAPHGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRGPLAHSGTFNNNVMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRSSEDLAAVDGRLRQLLFFHLLNEDIYSSPRGF--VVLSLPLTDADIDRYVAAIGSFIGGH 440
17 -92.4005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  26  41WLYGAPLHWMQQWP-GNCPLLVKEAQGARVTDIDGQQYVDFALGDSGAMFGHAQPAVADAIARQARRGSTLMLPTEDSLWVGAELARR-FGLPYWQVTTSATDANRFVLRLCRMLSGRDKVVVFNCNYHGSVDESQVEFDAAGRMVPRAGVHPNGVRHATTTRLVEFNDLDALEAALAH--GDVAAVLTEPFMTNVGMVPPAEGFHAGLRELTRRHDVALIIDETHT-ISCGPAGYSGAHGLEPDFFVLGKCIAGGIPSAVWGCSQAQAERIWAVLPFGFGGTLAGNALQLAAMRATFAEVMTEDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIGARVEYLFMTHAPRNGGEAHHANGLIEACLHLYLLNRGVLLTPFH-NMALTCPATRAEDVELHDRLLRDCLGEL 456
18 -83.9006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  21  17MTKNSSLLAECPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLL--LSAGYHGYDPMWY--------------PSEAPLEPNADGVVDFFFDLGLLRELLR-APERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTA-ELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEV-----SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEE-------------ALYGAANAEGLLFYAGD--NQGVSAAFDEAVLGEAERRFARVCERL 387
19 -83.3006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  21  7LLAEFPTCPRD---EKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLL--LSAGYHGYDPMWY--------------PSEAPLEPNADGVVDFFFDLGLLRELLR-APERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTA-ELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEV-----SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEE-------------ALYGAANAEGLLFYAGD--NQGVSAAFDEAVLGEAERRFARVCERL 371
20 -80.8006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  21  19IDIGAGKLLAQEPTADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDR--SIVLSSGYHGYDPMWHCDEP------FTPNQHGI---------VEFLFDLDVLAEWL-SRPEQVAAVVISPDHMHLG-----ERWYTEFTRLTKEADVPVIADEVKVGLRYRAGLST--PLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDV-----SFTSYFEPTAMAAATTTLRRMATGEPQQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVAD-------------AFHAAAAAEGLLFFEGD--NQTPSAAFTDEVVEDACGRIDRVSAAL 388
21 -55.4001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  27  23.................HPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQYEPYLELCEIMNQKVPGAKKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAMPGHVYRALYPCPLHGISEDDAIASIHRIFKNDPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGG---LGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFED-----GDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRIL-EDAQIRQGLEIISQCFDEA 424
22 -54.2001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  21  25.................EPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK-LFSGMLSRPVVDLATRLANITPPLDRALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPRFERLDYAFDLIDRQSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELG-YLFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKD-----RRTKEPADGLGAKITRECMNLGLSMNIGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA 432
23 -54.2004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  23  46.................VPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHTCFMVTPYEGYVAVTEQLNRLTPGAKRTVLFNSGAEAVENAVKVARLATGRDAVVAFDHAYHGRTNLTMALTAKAMPYKT-PFAPEVYRMPMSYPFREENPEAKRAITMIEKQGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFRTGEWFAVDHEGVVPDIITMAKGIAGGLPLSAITGRADLLDAVHPGG---LGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAEGSVVGDIRGRGAMLAIELVQP------GSKEPNAELTKAVAAACLKEGVIILTCGTYGNVIRLL-SDELLIDGLEVLAAAIKAH 455
24 -53.9005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  21  38..................PLELVSGSGVWLTDAQGKVYLDGYN--NVPHVGHANPAVADAIYQQLLTNLHTRYLNSRVVEYAEALLSKFDGLERLFLTNSGSEANELALRIARQHTGNTGVLVSDFSYHGNTTSLAEITTAHVRALRIPDVSGIAEVDVPVLLEQSLADVDAAIASLQAAGHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFRTGSG-GYQMFNVEPELVTMGKPMGNGHPIGAVVTTAELLDEFGRHNM--FFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIAQRSGNVGSVRGRGLFFGIDIIES-----DGSRNPAPALTKILIEDMRERGVLISRVGPHDNVLKMR-GREHADILLGQLELSLASL 438
25 -53.9005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  23  27.................LPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRANSKLGEYEQKITS-LLGFDKVLPMNSGAEAVETAVKLARKWENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYPFTPGF--------IRIPYNDIAALEEVLSKEAGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIRTGKLIACHHEDVQPDILILGKALSGGMPVSAVLANNNIMDVIKPGQ---HGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLIEKTDLITKVRGKGLLNAILINDTP----------DSSTAWNLCLALKENGLLAKPTHGNIIRLALVITEEQLLDCVKIIEKTILEF 413
26 -53.4005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  22  33..................PVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDR-VWDTYATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSYRSGLSYNSAVLMAPSPNMFQDSDGNVKYTRRMIENYGEQVAAVITEVSQGAGSAMPP-YEYIPQIRKMTKELGVLWINDEVLTGFRTGKWFGYQHYGVQPDIITMGKGLSSSLPAGAVLVSKEIAAFMD-KHRWESVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKNFTHGMNPNQIPTQIIMKKALEKGVLIGGVMPNTMRIGLNVSRGDIDKAMDALDYALDYL 468
27 -53.2005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  22  33..................PVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDR-VWDTYATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSFRSGLSCSSAVLMAPSSNTFQDSNGNVKYTRRMIENYGEQVAAVITEVSQGVGSTMPP-YEYVPQIRKMTKELGVLWISDEVLTGFRTGKWFGYQHYGVQPDIITMGKGLSSSLPAGAVVVSKEIAAFMD-KHRWESVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKNFRHGMNPNQIPTQIIMEKALEKGVLIGGAMPNTMRIGLNVSRGDIDKAMDALDYALDYL 468
28 -53.2003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  25  50.................LPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAATCFMVTPYEGYVKVAEHLNRLTPGEKRTALFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKH-PFANEVYRVPTSYPFRDGETDAHALDLINKQGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFRTGALFACEHENVVPDLIVTAKGIAGGLPLSAVTGRAEIMDGPQSGG---LGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVKP------GTTEPDADLTKRVAAAAHAQGLVVLTCGTYGNVLRFL-PDHLLDEGLDILAAVFAEV 452
29 -53.0004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  22  52.................VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRANDVTGPACRFMAE-MFGYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGT---HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDS------------DAIDPNDVVMKLKENGILSKPTRGRVMRFPLVITDEEHRDATTRIIKSFLAV 435
30 -53.0004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  23  39.................YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQK-TPAYFHHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTR-PMLPSVVHVPYPDSYRTYPGEFNEFKKPFESFADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLRTGK-AIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPA---HLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKD-----PKTKEPDSDAATKVIYYAFAHGVVIITLAGNILRFQLVIPREQLDQALQVLDDAFTAV 446
31 -52.9003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  23  43.................MPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDTCFMVTPYEGYVAVCEQLNRLTPVDKRSALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKVMPYKD--------GPFAPEIYRAPLSYAKRAITVIDKQADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFRTGAMFACEHEGIDPDLIVTAKGIAGGLPLSAVTGRAEIMDSPHVSG---LGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLQAEDDRIGDVRGRGAMIAMELVKA------GTTEPDADLTKALCAGAHAAGVIVLSCGTYGNVVRFL-GDDLLNEGLDVLEEVLRG. 450
32 -52.8001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  24  58.................LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRANNVLGEYEEYITK-LFNYHKVLPMNTGVEAGETACKLARKWKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFPFMPGF--------DIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLRTGRWLAVDYENVRPDIVLLGKALSGGLPVSAVLCDDDIMLTIKPGE---HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKL--PSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLR-----------LRDNGLLAKPTHGDIIRFPLVIKEDELRESIEIINKTILSF 439
33 -52.7005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  21  49..................ARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLENLFFQTAHPPALELAKAIADIAPGMNHVFFTGSGSESNDTVLRMVRHYPQKKVVIGRWNGYHGSTVAGVSLGGMKALHSQGLPIPGIVHIAQPYWYGEGGDMAEQLEKKILEVGEEVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFRTGEWFGSQYYGNAPDLMPIAKGLTSGYPMGGVIVRDEIVDTLNEGGEFYHGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQELADHPLVGEARGVGMVGALEL----VKNKKTRERFENGVGMLCREHCFRNGLIMRAVGDTMIISPLVITKPEIDELITLARKCLDQT 462
34 -52.6004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  24  46.................APVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHTCFMVTPYEQYVQVAELLNALTPGDKRTALFNSGAEAVENAIKVARLATGRPAVVAFDNAYHGRTNLTMALTAKSMPYKS-PFAPEVYRMPASYPLRDEPG-ISRIETQIG--AQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFRTGAWFASEHEGIVPDIVTMAKGIAGGMPLSAVTGRAELMDAVYAGG---LGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVKP------GTLEPDAALTKSIAAEALSQGVLILTCGTFGNVIRLL-GDDLLDEGITALSDIIRAK 449
35 -52.5003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  24  54.................LPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQTCFMVTPYEQYVAVAEQLNRITPGEKRTVLFNSGAEAVENSIKVARAHTRKQAVVAFDYAYHGRTNLTMALTAKSMPYKS-PFAPEIYRAPVSYPYRDNLLDAERAINLIDKQAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFRTGAMFACDHENVEPDLIVTAKGIADGFPLSAVTGRAEIMDAPHTSG---LGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQAADDRLGDVRGRGAMIAMELVKS------GTAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIRLL-SDELLSEGLDILCQILAD. 461
36 -52.5004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  22  37.................VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRANDVTGPACRFMAE-MFGYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGT---HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDS------------DAIDPNDVVMKLKENGILSKPTRGRVMRFPLVITDEEHRDATTRIIKSFLAV 420
37 -52.4001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  30  27.................HDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPLPTPMRGEFYRTLTAILPPLNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPF-------LPLVEPVEFIPYNDVEALKRAVD---EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGG---HGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPK---REVRGMGLMVGLELKEKAA--------------PYIARLEKEHRVLALQAGPTVIRFPLVIEKEDLERVVEAVRAVLA.. 395
38 -52.4001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  21  41.................IPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRASVPLGICERYLTN-LLGYDKVLMMNTGAEANETAYKLCRKWENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFPFAPQF--------SKVPYDDLEALEEELKD--PNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGE---HGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKN------------ELVNVLDICLKLKENGLITRDVHDKTIRLPLCITKEQLDECTEIIVKTVKFF 423
39 -52.3004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  26  65..................AVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRKPF-------MPLLPGFRHVPFGNIEAMRTALNECGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLF-DNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIG-------------YNFASEMFRQRVLVAGTLNNAKTIRIE-TIEQCELVIKAARKALAAM 452
40 -52.3004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  23  402....INPMMVDFLKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDA-IQYISIPEQTAKLAEVLCRLAPGMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSITGRDKHRRYF-------TPLLDAMVEVPFGDLAALREALNR--EDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLRTGKLFACEWDGIEPDVLMLSKSLSGGLPIGATLCRADLWQKAYGTRFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQFDQAFTGA--------------VNASAREFATRLPGDWHTTWKFLPDPVQAHLRAAMDRMEQALGEM 794
41 -52.2005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  25  26.................FPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANASILSASNAPAVALAERLTASFPGTHKVWFGHSGSDANEAAYRAITRATGRTGVIAFIGAYHGCTVGSMAFSGHSVQADA-AKADGLILLPYPDPYRPYQDDLALLKERLAAPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAF----AMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLAERHELIGDIRGRGLACGVELVRN-----RQSREPARAETAKLIYRAYELGLVLYYVGMNGNVLEMT-TEDEVRHAVNLLDQAFTEL 426
42 -52.2004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  27  33.................ADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTS-TNEPALRLGRKLID-ATFAERVLFMNSGTEANETAFKLARHYPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADI--------IHVPFNDLHAVKAVMD---DHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGS---HGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYA-----------GAEAGVMVLNAGADVMRFSLVVEEADIHEGMQRFAQAVGKV 412
43 -52.1003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  22  28.................IPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRASDSLGVCERYLTN-LFGYDKVLMMNTGAEASETAYKLCRKWENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFPFVPNF--------LKVPYDDLEALEKELQD--PNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLRTGKLLCTHHYGVKPDVILLGKALSGGYPISAILANDDVMLVLKPGE---HGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKN------------DLVNVWDICLKFKENGLITRSVHDKTVRLPLCITKEQLDECTEIIVKTVKFF 410
44 -52.1003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  25  32.................FPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANATILSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADA-AKADGLILLPYPDPYRPYRNDLTLLTEKLAAPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAF----AMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCD-----RQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLEFT-TETDIHKALDLLDRAFSEL 432
45 -52.1003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  18  38..................TRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRENTFFKTTHVPAIALAQKLAELAPGLNHVFFAGGGSEANDTNIRMVRTYPEKTVIISRKNAYHGSTVASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMARELEEAILELGNRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFRTGNWFGTQTMGIRPHIMTIAKGLSSGYPIGGSIVCDEVAHVIGK-DEFNHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASR-AKFASEPGTIGYICRERCFANNLIMRHVGDRMIISPLVITPAEIDEMFVRIRKSLDEA 452
46 -52.0005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  26  63..................AVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRKPF-------MPLLPGFRHVPFGNIEAMRTALNECGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLF-DNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIG-------------YNFASEMFRQRVLVAGTLNNAKTIRIE-TIEQCELVIKAARKALAAM 450
47 -51.9004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  27  21.................APFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTG-TNEPVLRLAKKLID-ATFADRVFFCNSGAEANEAALKLARKFSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDF-------APLPADIRHAAYNDINSASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGT---HGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQE-----------AAKAGVMVLIAGGNVVRFALNVSEEEVTTGLDRFAAACEHF 400
48 -51.9005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  23  51.................YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQK-TPAYFHHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTR-PMLPSVVHVPYPDSYRTYPGEFNEFKKPFESFADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLRTGK-AIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPA---HLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKD-----PKTKEPDSDAATKVIYYAFAHGVVIITLAGNILRFQLVIPREQLDQALQVLDDAFTAV 458
49 -51.4003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  21  32..................TTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQT-FPMSQSHEPAIKLAEKLNEWLGGEYVIFFSNSGSEANETAFKIARQYYHRYKFMSRYRGYHGNTMATMAATGQAQRRYQYPFASGFLHVTPPDCYRMPGIEVKEVDRVMTWELETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFRTGKAFGFMNYDVKPDIITMAKGITSAYPLSATAVKREIYEAFKGKGEFRHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGIEL----VNDKETKEPIDNDKIASVVNACKEKGLIIGRNGMTTAGYNLVISSEEIAFVIGTLKTAMERI 452
50 -51.0004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  21  44..................TVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERHAAFGKMSDQTVMLSEKLVEVSPFSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGATAVSASMTGFPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKD--KASKTPFDGNLSVSERIANTCTDLGLICFPLGQSVVLCPFILTEAQMDEMFDKLEKALDKV 462
51 -51.0005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  22  34......THAYDHASGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQHTYVGHSNDPVIELSSRIIEDWAGMKKVFYGMSGSDANETQIKLVWYYNNKKKIIARERSYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYNAPPGMVEELEKLIAREGDTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFRLGSKTGSEHYGIKPDLITVAKGLTSAYPLSAVIVSEKVWDVIEKGGVMGHGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KGARTPFDPALKVSQKVAAAALEDGLIVRALPHGDILGPLVTTRAEVDEIVAIAKEAFDEV 468
52 -50.9003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  23  18.................FDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTS--NENIAAAAKNLAK-ASALERVFFTNSGTESIEGAMKTARKYAKGGQFIAFKHSFHGRTLGALSLTANEKYQKPF-------KPLISGVKFAKYNDISSVEKLVN---EKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSLEAGD--HGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKS-------------VKVAKVIQKCQENALLLISCGENDLRFPLILQKEHIDEMSEKLRKALKSF 395
53 -50.8005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  34......THAHDHASGALPGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKEHTYVGHSTEAIIELSSRIIRDWAGMKKVYYGLSGSDANETQIKLVRYYNQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFLPVEGIKHTVCPHWYKAPAGMADELEKLILAEGDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFRLGSKMGSQRYGMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIEKAGAMGHGWTYSGHPICAAAALANLDILERENLTANAADVGAYLNQRLRETFEGHPLVGEVRGDGMLAALEFMAD--REARTPFDPALKVGPKVSAACLEDGMIARAMPHGDILGPLVLTRAEADEIVGIAKAAVDEV 468
54 -50.8004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  22  44..................TVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGADIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKD--KASKTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKV 462
55 -50.8004grx_A mol:protein length:465 Aminotransferase  ali model follow..  20  42..................TVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRHAFFGRMSDQTVMLSEKLVEVSPFNGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFIHLTCPHYWRYGEEGARELEDTITREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFRTGNTWGCLTYDFMPDAIISSKNLTAGFPMGAVILGPDLAKRVEAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKR-IADRPNIGEYRGIGFMWALEAVKD--KPTKTPFDANLSVSERIANTCTDLGLICRPLGQSIVLCPFILTEAQMDEMFEKLEKALDKV 460
56 -50.7003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  21  44..................TVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPFSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKDKAS--KTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKV 462
57 -50.7004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  23  36......MPFSANRNFHKDPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGT-PGFQYGHPLSFQLAEKIAQMTPTLDHVFFTGSGSECADTSIKMARAYAQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGPLMDVDHLPHTLQPGMAFTKANELLKLIELHDSNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFRMGKATGAEYFGVTPDIMNVAKQVTNGAPMGAVIASSEIYDTFEYAVEFGHGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGLKGTKNVI-DIRNCGLAGAIQIAARD--------GDAIVRPFEASMKLWKEGFYVRFGGDTLQFGTFNAKPEDLDRLFDAVGEALNGV 461
58 -50.7005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  34......THAHDHASGALPGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQHTYVGHSTDAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKIVWYYNNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYKAPAGMVEELEKLIAREGDTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFRLGSKMGAQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAAALEDGVIARAMPHGDILGPLVTTRAEVDEIVGIVKQAVDEV 468
59 -50.6005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  34......THAHDHASGALPGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKEHTYVGHSTEAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFLPIERIKHTVCPHWYKAPAGMADELEKLILAEGDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFRLGSKMGSQHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLRETFGGHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAACLEDGMIARAMPHGDILGPLVITRAEVDEIVGIAKQAVDEV 468
60 -50.5003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  20  21......THLAQHARGESANRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQAREHSYVGHGTEASITLAKMILDRAPKMSKVYFGLGGSDANETNVKLIWYYNEKKKIISRWRGYHGSGLVTGSLTGLELFHKKFLPVEQVIHTEAPYYFRREDLNVAELEALIEREGADIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFRLGTMFGSDHYGLEPDIITIAKGLTSAYPLSGSIVSDKVWKVLEQGGPIGHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEALSQHANVGDVRGEGLLCAVEFVKD--RDSRTFFDAADKIGPQISAKLLEQDKIIARAMPQGDILGFA-TRAEADQVVEGTLRAVKAV 456
61 -50.5002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  26  16.................FPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCS-WNRPQMELAELLSK-NTFGGKVFFANTGTEANEAAIKIARKYEKKYRILSAHNSFHGRTLGSLTATGQPKYQKPF-------EPLVPGFEYFEFNNVEDLRRKMS---EDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVN-ERANVLEPGD---HGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSN-------------REVATKCFENKLLVVPAGNNTIRFPLTVEYGEIDLAVETLKKVLQGI 391
62 -50.5005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  22  34......THAHDHASGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQHTYVGHSTDAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKLVWYYNNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYRAPAGMVEELEKLIAREGDTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFRLGSKMGSQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAAALEDGMIARAMPHGDILGPLVTTRAEVDEIVGIAKQAVDEV 468
63 -50.4005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  21  34......THAHDHASGALPGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQHTYVGHASEAIIELSARIIRDWAGMKKVYYGLSGSDANETQVKLVRYYNQKKKIISRQRGYHGSGIVTGSLTGLASFHQHFLPVEGVKHTLCPHFYKAPAGMAQELENLILAEGDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFRLGDKMGSQRHAMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIDSAGAMGHGWTYSGHPICAAAALANLDILERENITANAADVGGYLNQQLRQAFEGHPLVGEVRGDGMLAALEFMAD--REARTPFDAALKVGPKVSAACLERGMIARAMPHGDILGPLVLSRAEADEVVGIAKAAVDAV 468
64 -50.3004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  19  33..................ARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEENTFFKTTHPAVVELSSLLAEVTPAFDRVFYTNSGSESVDTMIRMVRRYPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGLPIPGMAHIEQPWWYKHGKDMARWLEEKILEIGDKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFRTGEWFGHQHFGFQPDLFTAAKGLSSGYPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAK--RELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPLVMTRAEVDEMLAVAERCLEEF 449
65 -50.3005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  34......THLRDHASGELPGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKEHTYVGHSNEPIIELSERIIREWAGMSKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPAFHNHFLPLEPIRHTTCPHYYRAPAGMADELEKMILAEGDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFRTGSMFGSHHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWKVLEQGGPIGHGWTYSGHPICAAAALANLDIIERENLTGNAADTGAYFQQRMRETFGDHPLVGEVRGVGLMAALEFVAD--KDKRTRFDPSLKVGPRVSAACLEDGMIARAMPHGDILGPLVITRAEVDEIVDIAKQAVDAV 468
66 -50.3003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  18  22......THMGTHARGESPTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNHAYVGHGTEASITLAKMIIDRAPKMSRVYFGLSGSDANETNIKLIWYYNEKKKIISRWRGYHG---SGVMTGSLTGLDLFHNAFDLPRAPVLHTEAPYYFRRADKLEEMILAEGPEIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFRLGTMFGSDHYGIKPDLITIAKGLTSAYPLSGVIVADRVWQVLVQGGSLGHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVAD--KDDRVFFDASQKIGPQVATALAASGVIGRAMPQGDILGPLCLTREQADIVVSKTADAVKSV 456
67 -50.3005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  23  30..................TLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDEQTFDGIAHPRVFDLAERLTGMFARMARVLFSSGGSDAVETALKMARQYPGRTRFLSLRNGYHGVHMGGTSVGGNGVYHYNHQLLAGCHLLDTPWLYRNPWDCIRQLEEQIALLGQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFRSGCMLGSRGWGVAPDILCLAKGITAGYPLGATLFNQRIADAIENGQGIMHGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLVERYAVVGEVRGKGLMIALDLVSD--KRTRQPLDPAAGQPSRIADEARRAGVLVRPIGNKIILSPLTLTRDEAGLMVSALEAAFARC 451
68 -50.1004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  23  22......MPFSANRNFQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGT-PGFQYGHPLSFQLAEKIAGLLPELNHVFFTGSGSECADTSIKMARAYPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRANELLKLIELHDSNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFRLGTYSGAEYFGVTPDLMNVAKQVTNGAPMGAVIASSEIYDTFEHAVEFSHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQGAKNVI-DIRNCGLAGAIQIAPRD--------GDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGTFNARPEELDRLFDAVGEALNGI 447
69 -50.0006erk_A mol:protein length:451 Aminotransferase  ali model follow..  21  41..................NIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGK-MFGGLTHQPAIDLGKKLLSIVPGLDAIFYADSGSIAVEVALKMALQYPSKCQFASTHSGYYGDTWHAMSVCDPINGMHSLPMQHFVAAPPMGFERDLTQSEREALTEFFVKNSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFRSGKLFACEHAAISPDIMTIGKALTGGMTFAATLSTREIADTISDYPALMHGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPAVSLEGVK-EVRCLGAVAVIELNEA-------------VDMPIFQTLLINNGIWVRPFGKLVYIMPYVITDDELTTLCQALLKVVSSY 440
70 -50.0001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  23  26..................VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFRTGKLFACEHAEIAPDILCLGKALTGGMTLSATLTTREVAETIGEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVA-DVRVLGAIGVVETTHP-------------VNMAALQKFFVEQGVWIAPFGKLIYLMPYIILPQQLQRLTAAVNRAVQDE 424
71 -49.9001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  22  26..................VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-MFGEITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFRTGKLFACEHAEIAPDILCLGKALTGGMTLSATLTTREVAETIGEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVA-DVRVLGAIGVVETTHP-------------VNMAALQKFFVEQGVWIRPFGKLIYLMPYIILPQQLQRLTAAVNRAVQDE 424
72 -49.9005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  22  28..................VFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYESRQRFLTFRNGYHGDTFGAMSVCDPHNSMHSLAENLFAPAPQSRMGGEWDERDMVAFARLMAAHRHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFRTGRLFACEHAGIAPDILCLGKALTGGMTLSATLTSRQVAETIGEAGCFMHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPAADSPQVA-DVRVLGAIGVVETTRP-------------VNIAALQQFFVRQGVWVRPFGKLIYLMPYIIQPEQLRRLTQAVNEAVREE 426
73 -49.8003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  23  42......HPYSSIGREAVSPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV-MFGGLTHEPAARLAKLLVDITPGLDTVFFSDSGSVSVEVAAKMALQYPGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSL-------TDVLAAQVFAPQAYSAAFEAQLAQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFRTGALFAADHAGVSPDIMCVGKALTGGLSLAATLCTADVAHTIGAAGALMRGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDT-ARALPAVTDVRVCGAIGVIECDRP-------------VDLAVATPAALDRGVWLRPFRNLVYAMPYICTPAEITQITSAMVEVARLV 452
74 -49.8003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  26  18.................LPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRASDQLGPWYEKVAK-LTNKEMVLPMNTGAEAVETAIKTARRWANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGF-------GPMLPGIIVIPYGDLEALKAAIT---PNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLRTGKVFACDWDNVTPDMYILGKALGGGFPISCAAANRDILGVFEPGS---HGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPA---------------RPYCEQLKAAGLLCKETHENVIRIPLVISEEDLEWAFQKIKAVLS.. 392
75 -49.6003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  23  37......HPYSSIGREAVSPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV-MFGGLTHEPAARLAKLLVDITPGLDTVFFSDSGSVSVEVAAKMALQYPGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSL-------TDVLAAQVFAPQAYSAAFEAQLAQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFRTGALFAADHAGVSPDIMCVGKALTGGLSLAATLCTADVAHTIGAAGALMHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARALPAVT-DVRVCGAIGVIECDRP-------------VDLAVATPAALDRGVWLRPFRNLVYAMPYICTPAEITQITSAMVEVARLV 447

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.