current user: public

If you have questions about the server, please let us know.

Query: 2czy_A mol:protein length:77 Paired amphipathic helix protein Sin3b, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKLast
1 -42.1002czy_A mol:protein length:77 Paired amphipathic helix protein Sin3b  ali model  100  1PVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPK 77
2 -37.9002cr7_A mol:protein length:80 Paired amphipathic helix protein Sin3b  ali model follow..  93  7GVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPSGPSS.... 79
3 -37.3002rmr_A mol:protein length:71 Paired amphipathic helix protein Sin3a  ali model follow..  75  2RLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPG....... 71
4 -36.4002f05_A mol:protein length:105 Paired amphipathic helix protein Sin3b  ali model follow..  29  4SVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTG 90
5 -36.1002l9s_B mol:protein length:94 Paired amphipathic helix protein Sin3a  ali model follow..  31  10PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQLTEQEVYAQVARLFKNQEDLLSEFGQFLPDANS..... 94
6 -29.2002ld7_B mol:protein length:75 Paired amphipathic helix protein Sin3a  ali model follow..  22  5KHGVGTESLFFDKVRKALRS-AEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKES..... 75
7 -15.5004ykd_A mol:protein length:96 Malcavernin  ali model follow..  13  7..ATELLQDYMLTLRTKL--SSQEIQQFAALLHEYRNGA-SIHEFCINLRQLYGSRKFLLLGLRPFIPEKDSQHFEN 79
8 -15.0004fqn_A mol:protein length:98 Malcavernin  ali model follow..  13  14..ATELLQDYMLTLRTKL--SSQEIQQFAALLHEYRNGA-SIHEFCINLRQLYGSRKFLLLGLRPFIPEKDSQHFEN 86
9 -13.7004ykc_A mol:protein length:164 Malcavernin  ali model follow..  13  7..ATELLQDYMLTLRTKL--SSQEIQQFAALLHEYRNGA-SIHEFCINLRQLYGSRKFLLLGLRPFIPEKDSQHFEN 79
10 -7.0606fdd_A mol:protein length:85 Whirlin  ali model follow..  8....QTRALLDDQARHLLTEQE--RATMMYYLAQYRGGTISVEAMVMALFELLNTHAKLLSEVRSIISPQDLDRFDH 80

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.