current user: public

If you have questions about the server, please let us know.

Query: 2d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISGLast
1 -67.1002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model  100  1DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG 142
2 -65.0003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  51  2ECGPLQRLKVKRQWAEAYGSGNGREEFGHFIWANVFKVAPSARDMFKRVRGDNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGIQG 143
3 -64.9001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  50  3VCGPLQRLKVKRQWAEAYGSGNSREEFGHFIWSHVFQHSPAARDMFKRVRGDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGIQG 144
4 -62.7004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  41  1DCSILELLKVKNQWREAFGEGHHRVQFGLELWKRFFDTHPEVKGLFKGVNGDNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQ-DAWTKCFHTIADGIKG 141
5 -61.9001x9f_D mol:protein length:140 hemoglobin chain d1  ali model follow..  36  1ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDF-GAWHDCVDQIIDGIK. 140
6 -61.7003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  43  1DCNILQRLKVKMQWAKAYGFGTERAKFGNSLWTSIFNYAPDARDLFKSVKSEDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDL-PAWESCYKVIAMGITG 141
7 -61.1004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  44  2ECDVLTRLKVKAQWRRAYSHGHNREDFAQAIWRALFAQVPDSRTLFKRVHGHDTTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDK-DAWSACFDHIAHGIKG 142
8 -60.6002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  38  2.CNRLEQILVKTQWAQSYGEAENRAAFSRDLFSELFNIQGSSRALFSGVGVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTHLDCF--NQHAWGECYERIASGISG 140
9 -60.3001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  39  3QCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDR-EAWDACIDHIEDGIKG 143
10 -59.4001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  42  2.CAMLERAKVKDEWAKAYGIGAARSKFGDALWRNVFNYAPNARDIFESVNSKDMASPEFKAHIARVLGGLDRVISMLDNQATLDADLAHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVCFDV-PAWQGCYNIIAKGITG 141
11 -57.2001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  16  1SLSAAEADLAGKSWAPV---FANKNANGDAFLVALFEKFPDSANFFADFKADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKA 143
12 -57.0001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  16  2SLSAAEADLAGKSWAPV---FANKNANGLDFLVALFEKFPDSANFFADFKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKA 144
13 -55.5003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  21  4.LTGPQKAALKSSWSRF---MNNAVTNGTNFYMDLFKAYPDTLTPFKSLFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCHVEGSTKNAWEDFIAYICRVQGD 146
14 -55.5002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  19  3HMERPESELIRQSWRVV---SRSPLEHGTVLFARLFALEPSLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATAWSRLYGAVVQAMSR 149
15 -55.4004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  23  13.SNADQKDLLRMSWGVL---SVDMEGTGLMLMANLFKTSPSAKGKFARLGDAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDAAWASLVAVVQAAL.. 152
16 -55.3002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  14  3.LTQTQIDSILADLAHHTDTTEHITEMGVSIYKTLFAAHPEYISYFSKLQDNVGQSEGIRYYGRTLGEELIRLLKAASNPSVLEERIVQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQED-KDAIEKFLLHVMQAIAA 146
17 -55.3004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  12  8QVSEEQQSLIMEDVQVL---LPNYDDFVEDVLQQFMEENPETFQIFPWADKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEA-EKKEAWLKAYGIITVMVT. 153
18 -55.3001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  21  1.MERPEPELIRQSWRAV---SRSPLEHGTVLFARLFALEPDLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPAAAWSQLYGAVVQAMSR 146
19 -55.1004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  21  1.MERPEPELIRQSWRAV---SRSPLEHGTVLFARLFALEPDLLPLFQYNCEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPAAAWSQLYGAVVQAMSR 146
20 -54.9004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  20  11.GSEAIKANLRRSWGVL---SADIEATGLMLMSNLFTLRPDTKTYFTRLGQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDGAWAALVGVVQAAL.. 150
21 -54.6001kfr_A mol:protein length:147 Hemoglobin  ali model follow..  11  1TLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYISHFSRLEENVMQSDGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVADAEG-KAAVEKFLKHVFPMMAA 145
22 -54.5004u8u_A mol:protein length:150 Globin a chain  ali model follow..  27  5.CSAEDRREIQHIWDTVWSFTDRKVAIAGAVFKDLFHHYPSAKGLFERVKVAEPDSGEYHSHLVRVANGLDLLINLFQDTQVLDKQLAHLAEQHIRKGVTQQFFKGIGESFARVFPQVSSC--FNLEAWNRCFHTLADRISR 146
23 -54.4001h97_A mol:protein length:147 GLOBIN-3  ali model follow..  11  1TLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYISHFSRLEENVMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAKFLKHVFPMMAAEI.. 147
24 -54.3004u8u_C mol:protein length:151 Globin c Chain  ali model follow..  26  5.CSAEDRNIVQKQWSVLWGDTESSIAFGRLILTKLAKEIPEVKELFNKVDIDNPEGGPFSAHCLRILNALDMSINLMDDPEALDSALDHLADQHHDRGVKKAHFKKIAEILHTGLQQVLDDYNA--LSWKSCFKGILGKIAS 147
25 -53.9002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  21  4.LTNPQKAAIRSSWSKF---MDNGVSNGQGFYMDLFKAHPETLTPFKSLLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMEDHNHMVGGAKDAWEVFVGFICKTLGD 146
26 -53.8001yhu_C mol:protein length:148 hemoglobin B1a chain  ali model follow..  35  3NCADAAAAIVQAQWEDVWSAAASRVSAGEEVFAALFKMVPAAKNLFTRVNVADINSPEFQGHVVRVMGGLDILINALDDIPTLESMLDHLAGQHAVRGVTGAGFQLMATVLMESLPQVVEGF--NPDAWASCLAGIAAAISS 146
27 -53.8001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  24  3.LTESQAALVKSSWEEF---NANIPKHTHRFFILVLEIAPAAKDLFSFLKEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEESAWTIAYDELAIVIKK 147
28 -53.6003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  20  10.FTEEQEALVVKSWAVM---KKNSAELGLKFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHAMTVFVMTCESAVQLRKAGVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPENAWGEAYDQLVAAIKS 155
29 -53.5002d2m_C mol:protein length:147 Giant hemoglobin, B2(c) globin chain  ali model follow..  34  4.CSSEDRANVMHNWDAAWSYSDRRVALAQAVFASLFSRDAAAQGLFSGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQARGVAAAHFDVMAEAFAEVMPQVSSC--FSSDSWNRCFARIANGISA 145
30 -53.5001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  19  2.LSAAQRQVIAATWKDIAG-ADNGAGVGKKCLIKFLSAHPQMAAVFGFSGA---SDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGGKMNAADAWAAAYADISGALIS 143
31 -53.5001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  20  1SLEAAQKSNVTSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD----EGAWTAVAGALMGEIEP 140
32 -53.5001x9f_C mol:protein length:153 Globin III, extracellular  ali model follow..  29  7.CSEEDHRIVQKQWDILWRDSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEREGVQKAHFKKFGEILATGLPQVLDDY--DALAWKSCLKGILTKISS 149
33 -53.4001yhu_D mol:protein length:149 hemoglobin B2 chain  ali model follow..  34  3SCTTEDRREMQLMWGNVWSFTGRRIAIAQAVFKDLFANVPDAVGLFGAVKGDEVNSNEFKAHCIRVVNGLDSSIGLLSDPATLNEQLSHLATQHKARGVTKGGFSAIAQSFLRVMPQVASC--FNPDAWSRCFNRITTGMTE 145
34 -53.4003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  19  10.FTEEQEALVVKAWAVM---KKNSAELGLQFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHATTVFVMTCESAVQLRKAGVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPENAWGVAYDQLVAAIKF 155
35 -53.4001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  20  1SLSAAQKDNVKSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGD----EGAWTAVAGALMGMIRP 140
36 -53.4001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  20  1SLSAAQKDNVTSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD----EGAWTAVAGALMGEIEP 140
37 -53.1003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  17  9.FTEEQEALVVKSWSVM---KKNSAELGLKLFIKIFEIAPTTKKMFSFLRDPAEQNPKLKPHAMSVFVMCCESAVQLRKTGVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEVAWGQAYDHLVAAIKA 154
38 -53.1001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  19  2.LSAAQRQVVASTWKDIAG-ADNGAGVGKECLSKFISAHPEMAAVFGFSGA---SDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAADAWAAAYGDISGALIS 143
39 -53.1001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  19  2.LSAAQRQVVASTWKDIAG-SDNGAGVGKECFTKFLSAHHDMAAVFGFSGA---SDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAADAWAAAYADISGALIS 143
40 -52.9001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  23  12DLTPAEKDLIRSTWDQL---MTHRTGFVADVFIRIFHNDPTAQRKFPQMAGELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQDAWAKTFAIVQGVLIT 155
41 -52.9003wct_C mol:protein length:150 B2 globin chain of giant V2 hemoglobin  ali model follow..  37  4SCTTEDRREMQLMWANVWSFTGRRLAIAQAVFKDLFAHVPDAVGLFDRVHGTEIDSSEFKAHCIRVVNGLDSAIGLLSDPSTLNEQLSHLATQHQERGVTKGGFSAIAQSFLRVMPQVASC--FNPDAWSRCFNRITNGMTE 146
42 -52.9002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  15  1.MNSEEVNDIKRTWEVV---AAKMTEAGVEMLKRYFKKYPHNLNHFPWFKDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKLNEKQVHAYHKFFDRAYDIAFA 145
43 -52.7001x9f_A mol:protein length:151 Globin IV, extracellular  ali model follow..  26  7.CSYEDRREIRHIWDDVWSSTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRGVTKEYFRGIGEAFARVLPQVLSCF--NVDAWNRCFHRLVARIAK 148
44 -52.7001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  25  12DLTLAQKKIVRKTWHQL---MRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKDAWAKAFSVVQAVLLV 155
45 -52.6001ith_A mol:protein length:141 HEMOGLOBIN (CYANO MET)  ali model follow..  15  2.LTAAQIKAIQDHWFLN--IKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSGLRSNPAYKAQTLTVINYLDKVVDALGGN--AGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVAAWGDAAGVLVAAMK. 141
46 -52.5001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  15  3.FTEKQDALVSSSFEAF---KANIPQYSVVFYTSILEKAPAAKDLFSFLANGVPTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDERAWEVAYDELAAAIKK 142
47 -52.2003wct_D mol:protein length:149 B1 globin chain of giant V2 hemoglobin  ali model follow..  31  4.CSEADATIVIKQWNQIYNAAKSRWTMGNEIFSSLFKLKPESEVLFNNVNVANMSSGAFHAHTVRVLSGLDMGINYLNDAGTLTSLTAHLAAQHVARGLKAVYFDAMGKVLMTVLPSLIDN--FNPDAWRNCLLPLKNAIAK 146
48 -52.2002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  19  10.FSEEKEALVLKSWAIM---KKDSANLGLRFFLKIFEIAPSARQMFPFLRVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALPADMEMRNAWGEAYDQLVAAIKQ 156
49 -52.2001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  18  13SFSEEQEALVLKSWAIL---KKDSANIALRFFLKIFEVAPSASQMFSFLRVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMAMKSAWSEAYDHLVAAIKQ 160
50 -52.1002zfo_D mol:protein length:145 Extracellular giant hemoglobin major globin subunit B1  ali model follow..  25  2CCSRGDAEVVISEWDQVFNAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGD--SSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAIGVTGAAVTHLSEAISSVVAQVLPSAHI--DAWGYCMAYIAAGIGA 143
51 -52.0002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  16  1.MNSDEVQLIKKTWEIP---VATPTDSGAAILTQFFNRFPSNLEKFPFRDEELSGNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAASSLDESQAATWAKLVDHVYAIIFK 144
52 -51.8002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  14  1.MTKEQIQIIKDCVPIL---QKNGEDLTNEFYKIMFNDYPEVKPMFNM------EKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYID 132
53 -51.7002r4x_A mol:protein length:146 Globin-1  ali model follow..  15  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
54 -51.7003uhc_A mol:protein length:146 Globin-1  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
55 -51.7003uh6_A mol:protein length:146 Globin-1  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGD-KYANAWAKLVAVVQAAL.. 146
56 -51.7003uhd_A mol:protein length:146 Globin-1  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
57 -51.7002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  19  13.FGEEQEALVLKSWAVM---KKDAANLGLRFFLKVFEIAPSAKQMFSFLRVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFEVTGFALLETIKEALPADMEMKKAWAEAYSQLVAAIKR 159
58 -51.6001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  16  4GLSDSEEKLVRDAWAPI---HGDLQGTANTVFYNYLKKYPSNQDKFETLKDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHVARPITHGSYNDLRGVIYDSMH-----DSTHGAAWNKMMDNFFYVFYE 142
59 -51.6003uhb_A mol:protein length:146 Globin-1  ali model follow..  15  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
60 -51.6003uhi_A mol:protein length:146 Globin-1  ali model follow..  17  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
61 -51.6003ugz_A mol:protein length:146 Globin-1  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVAAMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
62 -51.5002d2m_D mol:protein length:145 Giant hemoglobin, B1(d) globin chain  ali model follow..  25  2CCSRGDAEVVISEWDQVFNAGSSESAVGVAIFDAFFASSGVSPSMFPGGGD--SNNPEFLAQVSRVVSGADIAINSLTNRATCDSLLSHLNAQHRAIGVTGAAVTHLSQAISSVVAQVLPSAHI--DAWEYCMAYIAAGIGA 143
63 -51.5003ugy_A mol:protein length:146 Globin-1  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
64 -51.5002auo_A mol:protein length:146 Globin I  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
65 -51.5002grf_A mol:protein length:146 Globin-1  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVALVTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGD-KYANAWAKLVAVVQAAL.. 146
66 -51.5001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  16  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASK---GDKYANAWAKLVAVVQAAL.. 146
67 -51.4002r4z_A mol:protein length:146 Globin-1  ali model follow..  16  9QLTADVKKDLRDSWKVW---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGD-KYANAWAKLVAVVQAAL.. 146
68 -51.0001la6_A mol:protein length:143 Hemoglobin alpha-1 chain  ali model follow..  12  2SLSDKDKAAVRALWSKI---GKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVTPGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYK--LRVDPSNFKILNHCILVVISTMFPKEFTPEVSLDKFLSGVALALAE 140
69 -50.8003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  18  2.IDQKEKELIKESWKRI---EPNKNEIGLLFYANLFKEEPTVSVLF---------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAAWTKVYGIAAQVMTA 132
70 -50.7001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  17  2.LDQQTINIIKATVPVL---KEHGVTITTTFYKNLFAKHPEVRPLFDM------GRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDDAWGKAYGVIADVFIQ 135
71 -50.7001hbh_A mol:protein length:143 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  13  2SLSDKDKAAVRALWSKI---GKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYK--LRVDPANFKILNHCILVVISTMFPKEFTPEVSLDKFLSGVALALAE 140
72 -50.6005jgg_A mol:protein length:142 Alpha chain  ali model follow..  16  1TLTSADKSHVKSIWSKA---SGKAEELGAEALGRMLEVFPNTKTYFSHYADLSVTSGQVHTHGKKILDAITTAVNHIDDITGVLTALSTLH--AKTLRVDPANFKILSHTILVVLALYFPADFTPELACDKFLASVSHTLAT 139
73 -50.6001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  21  18ELSEAERKAVQAMWARL---YANSEDVGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPERAWAKLRGLIYSHVTA 164
74 -50.5005jnz_A mol:protein length:142 Alpha chain  ali model follow..  15  2.LTSADKSHVRSIWSKA---GGSAEEIGAEALGRMLESFPNTKTYFNHYADLSSSSAQVHTHGKKIIDALTTAVNHIDDITGALSSLSTLHAQT--LRVDPANFKILSHTILVVLALYFPADFTPELACDKFLANVSHALAN 139
75 -50.4003bcq_A mol:protein length:142 Alpha-chain hemoglobin  ali model follow..  13  2.LSDKDKDSIKAFWAKI---SPKAEDIGADALARMLTVYPQTKTYFSHWKDLSPGSAPVKKHGKTVMGSVAEAVSKIDDLTNGLLTLSELHAFQ--LRVDPANFKILSHNLLVVLAQQFPNDFTPEVSMDKFLSLLSWSLSE 139

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.