current user: public

If you have questions about the server, please let us know.

Query: 2dit_A mol:protein length:112 HIV TAT specific factor 1 variant, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst GSSGSSGGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQSGPSSGLast
1 -71.3002dit_A mol:protein length:112 HIV TAT specific factor 1 variant  ali model  100  1GSSGSSGGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQSGPSSG 112
2 -59.2004ru2_A mol:protein length:114 RNA-binding protein 39 (RBM39)  ali model follow..  27  3..........QPLATQCFQLSNMFNPQT-EEEVGWDTEIKDDVIEECNKHGGVIHIYVDKYSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDS. 102
3 -58.5004oz0_A mol:protein length:115 RNA-binding protein 39  ali model follow..  27  1.......GSVQPLATQCFQLSNMFNPQT-EEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDS. 103
4 -57.6005zoj_D mol:protein length:132 Inner nuclear membrane protein Man1  ali model follow..  20  11AFHLDRRNSPPNSLTPCLKIRNMFDPVM-EIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA. 120
5 -54.4002dny_A mol:protein length:119 Fuse-binding protein-interacting repressor, isoform b  ali model follow..  31  1GSSGSSGKLLRKQESTVMVLRNMVDPKDIDD------DLEGEVTEECGKFGAVNRVIIYQEKQGVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNS..... 109
6 -53.5003ue2_A mol:protein length:118 Poly(U)-binding-splicing factor PUF60  ali model follow..  25  11.....MQKLLRKQESTVMVLRNMVDPKDIDD------DLEGEVTEECGKFGAVNRVIIYQEKQGVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYD-QERFDNSDLSA 118
7 -51.4004fxw_A mol:protein length:106 Splicing factor U2AF 65 kDa subunit  ali model follow..  25  2..........PLGSTEVLCLMNMVLPEELL-DDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRR..... 103
8 -51.1002m52_A mol:protein length:105 Splicing factor U2AF 65 kDa subunit  ali model follow..  26  2...........GHPTEVLCLMNMVLPEELL-DDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRR..... 102
9 -49.7002pe8_A mol:protein length:105 Splicing factor 45  ali model follow..  22  1.......GAMGKCPTKVVLLRNMVGAGEVDE------DLEVETKEECEKYGKVGKCVIFEIPGAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVL..... 99
10 -42.8001jmt_A mol:protein length:104 SPLICING FACTOR U2AF 35 KDA SUBUNIT  ali model follow..  23  1..............SQTIALLNIYRNPQNSSQQEHYDEFFEEVFTEMEEYGEVEEMNVCDNHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSP............ 104
11 -27.3005gmk_a mol:protein length:111 U2 small nuclear ribonucleoprotein B``  ali model follow..  14  13RDTHHTVAEPVTEAKNTLYVSQL--NEKINMQ-----RLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSETK........ 109
12 -25.6006cmn_A mol:protein length:119 TAR-Binding Protein 6.7  ali model follow..  22  10LYFQGHMAVPETRPNHTIYINNL--NSKIKKD-----ELKKSLHAIFSRFGQILDILV-QRTPRGQAFVIFKEVSSATNALRSMQGFPFYDKPMAIQYAKTDKR........ 107
13 -24.0005fj4_A mol:protein length:102 U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A  ali model follow..  23  2.......AVPETRPNHTIYINNL--NEKIKKD-----ELKKSLHAIFSRFGQILDILVSRSKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD........ 92
14 -24.0002e44_A mol:protein length:96 Insulin-like growth factor 2 mRNA binding protein 3  ali model follow..  20  1GSSGSSGSVPKRQRIRKLQIRNI--PPHLQW---------EVLDSLLVQYGVVESCQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQ...... 96
15 -23.6002fho_B mol:protein length:87 spliceosomal protein p14  ali model follow..  19  1...GRANIRLPPEVNRILYIRNL------------YKITAEEMYDIFGKYGPIRQIRVGNTETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN............ 87
16 -23.4003jb9_k mol:protein length:111 Probable U2 small nuclear ribonucleoprotein B``  ali model follow..  18  2.............NQNTLYVNNL--NDKINKN-----DLRTALYMLFSTYGTVVDIVALKTKMRGQAHVVFFDPSAAAIAMKALKNFIFFGKEMKIQYAHSKSK........ 86
17 -23.3002f9d_A mol:protein length:125 Pre-mRNA branch site protein p14  ali model follow..  17  4QAAKRANIRLPPEVNRILYIRNL------------YKITAEEMYDIFGKYGPIRQIRVNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMD... 102
18 -23.3004pr6_A mol:protein length:95 U1 small nuclear ribonucleoprotein A  ali model follow..  23  1.........PETRPNHTIYINNL--NEKIKKD-----ELKKSLHAIFSRFGQILDILVSRSKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD........ 89
19 -23.3006f4g_B mol:protein length:98 U1 small nuclear ribonucleoprotein A  ali model follow..  21  1.......GAMEMLPNQTIYINNL--NEKIKKE-----ELKKSLYAIFSQFGQILDIVALKTKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSD........ 91
20 -23.0001x4a_A mol:protein length:109 splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor) variant  ali model follow..  30  36.......................................TKDIEDVFYKYGAIRDIDLNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGSGPSSG 109
21 -23.0002cqi_A mol:protein length:103 Nucleolysin TIAR  ali model follow..  23  1GSSGSSGMMEDDGQPRTLYVGNLSRDVT-----------EVLILQLFSQIGPCKSCKMEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKSGPSSG 103
22 -22.9002cpj_A mol:protein length:99 Non-POU domain-containing octamer-binding protein  ali model follow..  25  1GSSGSSGGEKTFTQRSRLFVGNLPPDIT-----------EEEMRKLFEKYGKAGEVFIHKDK--GFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTSGPSSG 99
23 -22.9004yb1_P mol:protein length:92 U1 small nuclear ribonucleoprotein A  ali model follow..  24  1............RPNHTIYINNL--NEKIKKD-----ELKKSLHAIFSRFGQILDILVKRSKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD........ 86
24 -22.6002dnm_A mol:protein length:103 SRp46 splicing factor  ali model follow..  30  27.......................................PDSLRRVFEKYGRVGDVYIHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLSGPSSG 103
25 -22.6003lqv_A mol:protein length:115 Pre-mRNA branch site protein p14  ali model follow..  19  4..........PPEVNRILYIRNL------------YKITAEEMYDIFGKYGPIRQIRVNTPETRGTAYVVYEDIFDAKNAVDHLSGFNVSNRYLVVLYYNANRAFQKMD... 92
26 -22.6002k3k_A mol:protein length:104 U1 small nuclear ribonucleoprotein A  ali model follow..  21  2..........EMLPNQTIYINNL--NEKIKKE-----ELKKSLYAIFSQFGQILDIVALKTKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSD........ 89
27 -22.5002cq3_A mol:protein length:103 RNA-binding protein 9  ali model follow..  30  1GSSGSSGNSESKSTPKRLHVSNI------------FRFRDPDLRQMFGQFGKILDVEINERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNSGPSSG 103
28 -22.4002cpx_A mol:protein length:115 Hypothetical protein FLJ11016  ali model follow..  19  20.........NPGEPNKVLYLKNLSPRVT-----------ERDLVSLFARFQEKKGPPIMTGRMRGQAFITFPNKEIAWQALHLVNGYKLYGKILVIEFGKNKKQRSSGPSSG 115
29 -22.4002fc9_A mol:protein length:101 NCL protein  ali model follow..  26  1GSSGSSGNSTWSGESKTLVLSNL------------YSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNSGPSSG 101
30 -22.3002a3j_A mol:protein length:127 U1 small nuclear ribonucleoprotein A  ali model follow..  17  21......STPPHTEPSQVVLITNI--NPEVPKE-----KLQALLYALASSQGDILDIVVDLSDNSGKAYIVFATQESAQAFVEAFQGYPFQGNPLVITFSETPQSQVAED... 117
31 -22.2005mqf_X mol:protein length:225 U2 small nuclear ribonucleoprotein B``  ali model follow..  21  2..........DIRPNHTIYINNM--NDKIKKE-----ELKRSLYALFSQFGHVVDIVALKTMKRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQY.............. 83
32 -22.1001x5p_A mol:protein length:97 Negative elongation factor E  ali model follow..  29  1GSSGSSGERRAPRKGNTLYVYGE----------------PTLLRGAFSPFGNIIDLSMDPPR--NCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDSGPSSG 97
33 -22.0002cph_A mol:protein length:107 RNA binding motif protein 19  ali model follow..  26  1GSSGSSGQVPKKQTTSKILVRNI------------FQANQREIRELFSTFGELKTVRLPKKAHRGFGFVDFITKQDAKKAFNALHSTHLYGRRLVLEWADSEVTVQSGPSSG 107
34 -22.0002cq0_A mol:protein length:103 Eukaryotic translation initiation factor 3 subunit 4  ali model follow..  25  1GSSGSSGPNRRADDNATIRVTNLSEDTR-----------ETDLQELFRPFGSISRIYLAKDKSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEW.............. 91
35 -22.0002rra_A mol:protein length:99 cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Homo sapiens transformer-2-beta (SFRS10) gene  ali model follow..  27  1GSSGSSGNRANPDPNCCLGVFGL------------LYTTERDLREVFSKYGPIADVSIQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDF.............. 91
36 -21.8001whw_A mol:protein length:99 hypothetical protein RIKEN CDNA 1200009A02  ali model follow..  23  1.......GSSGSSGSGRLFVRNL------------YTSSEEDLEKLFSAYGPLSELHYLTKKPKGFAFVTFMFPEHAVKAYAEVDGQVFQGRMLHVLPSTIKKEASQSGPSS 98
37 -21.7002dk2_A mol:protein length:97 Heterogeneous nuclear ribonucleoprotein R  ali model follow..  30  1GSSGSSGDPEVMAKVKVLFVRNLATTVT-----------EEILEKSFSEFGKLERVKKLK----DYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRSGPSSG 97
38 -21.7002mqn_A mol:protein length:216 Heterogenous nuclear ribonucleoprotein L  ali model follow..  16  4..........PHADSPVLMVYGL-DQSKMNCD---------RVFNVFCLYGNVEKVKFMKSKP-GAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCV.............. 80
39 -21.7001wf2_A mol:protein length:98 Heterogeneous nuclear ribonucleoproteins C1/C2  ali model follow..  29  1GSSGSSGKTDPRSMNSRVFIGNLNTLV------------KSDVEAIFSKYGKIVGCSVHK----GFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRSGPSSG 98
40 -21.6002wbr_A mol:protein length:89 GW182  ali model follow..  17  2.........AMAWGSSWLLLKNLTAQID-----------GPTLRTLCMQHGPLVSFHP--YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSENEVQSIMQH.. 89
41 -21.6002dgx_A mol:protein length:96 KIAA0430 protein  ali model follow..  15  1......GSSGSSGNGADVQVSNI--DYRLSRK-----ELQQLLQEAFARHGKVKSVEL-HTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLATGAS......... 91
42 -21.6002cqc_A mol:protein length:95 Arginine/serine-rich splicing factor 10  ali model follow..  27  1GSSGSSGNRANPDPNCCLGVFGL------------LYTTERDLREVFSKYGPIADVSIQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVSG.............. 91
43 -21.6005ev1_A mol:protein length:201 Splicing factor U2AF 65 kDa subunit  ali model follow..  18  132.......................................DDQVKELLTSFGPLKAFNLVKDSSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAK........ 200
44 -21.6003pgw_A mol:protein length:282 U1-A  ali model follow..  22  2.......AVPETRPNHTIYINNL--NEKIKKD-----ELKKSLYAIFSQFGQILDILVSRSKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDS......... 91
45 -21.5002hvz_A mol:protein length:101 Splicing factor, arginine/serine-rich 7  ali model follow..  28  14.......................................KGELERAFSYYGPLRTVWI-ARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPR........ 77
46 -21.4002jvo_A mol:protein length:108 Nucleolar protein 3  ali model follow..  18  39.......................................ESELNEIFGPFGPMKEVKILN----GFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSKLPAKRYR..... 102
47 -21.4003to8_A mol:protein length:218 Heterogeneous nuclear ribonucleoprotein L  ali model follow..  17  3.............DSPVLMVYGL-DQSKMNCD---------RVFNVFCLYGNVEKVKFMKSKP-GAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCV.............. 76
48 -21.4002cpd_A mol:protein length:99 APOBEC-1 stimulating protein  ali model follow..  26  1GSSGSSGDEDTMSSVKILYVRNLMLSTS-----------EEMIEKEFNNIKPGAVERV--KKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSSGPSSG 99
49 -21.3005gvq_A mol:protein length:105 Splicing factor 3B subunit 4  ali model follow..  26  1GSSGSSGPISERNQDATVYVGGLDEKVS-----------EPLLWELFLQAGPVVNTHMPKDQHQGYGFVEFLSEEDADYAIKIMDMIKLYGKPIRVNKASAHNKNLSGPSSG 105
50 -21.3001wex_A mol:protein length:104 HYPOTHETICAL PROTEIN (RIKEN CDNA 2810036L13)  ali model follow..  25  1GSSGSSGSHHKVSVSPVVHVRGLCESVV-----------EADLVEALEKFGTICYVMMMPFK--RQALVEFENIDSAKECVTFAADVYIAGQQAFFNY.............. 87
51 -21.2002yh0_A mol:protein length:198 SPLICING FACTOR U2AF 65 KDA SUBUNIT  ali model follow..  17  128.......................................DDQVKELLTSFGPLKAFNLVKDSSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA...... 198
52 -21.2002cpi_A mol:protein length:111 CCR4-NOT transcription complex subunit 4  ali model follow..  20  5....................SSGASVRVVQKNLVFVVGLSQRLADP-GKFGKIHKVVINNSGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASL.............. 97
53 -21.2002cq1_A mol:protein length:101 PTB-like protein L  ali model follow..  24  1GSSGSSGDKMDGAPSRVLHIRKL--PGEVTE---------TEVIALGLPFGKVTNILMLKGK--NQAFLELATEEAAITMVNYYSAVHLRNQPIYIQYSNHKELKTSGPSSG 101
54 -21.2002adc_A mol:protein length:229 Polypyrimidine tract-binding protein 1  ali model follow..  14  14HMGRIAIPGLAGAGNSVLLVSNL-NPERVTPQ---------SLFILFGVYGDVQRVKILFNKK-ENALVQMADGNQAQLAMSHLNGHKLHGKPIRITL.............. 100
55 -21.1001wf1_A mol:protein length:110 RNA-binding protein Raly  ali model follow..  24  42.......................................KSDVETIFSKYGRVAGCSVHK----GYAFVQYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRSGPSSG 110
56 -21.1002n3l_A mol:protein length:89 serine/arginine-rich protein 1, PfSR1-RRM1  ali model follow..  23  24.......................................SRDVENEFRKYGNILKCDVKKTSGAAFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEVPFNARE........ 89
57 -21.1002cqb_A mol:protein length:102 Peptidyl-prolyl cis-trans isomerase E  ali model follow..  26  1...GSSGSSGMATTKRVLYVGGLAEEVD-----------DKVLHAAFIPFGDITDIQIETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKESGPSSG 102
58 -21.1001x4d_A mol:protein length:102 Matrin 3  ali model follow..  26  1GSSGSSGQKGRVETRRVVHIMDF--QRGKNLR--------YQLLQLVEPFGVISNHLILNKI--NEAFIEMATTEDAQAAVDYYTPALVFGKPVRVHLSQKYKRIKSGPSSG 102
59 -21.0002d9p_A mol:protein length:103 Polyadenylate-binding protein 3  ali model follow..  32  1GSSGSSGDRITRYQVVNLYVKNL--DDGIDD---------ERLRKAFSPFGTITSAKVMMEGSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQSGPSSG 103
60 -21.0002rrb_A mol:protein length:96 cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Homo sapiens transformer-2-beta (SFRS10) gene  ali model follow..  28  26.......................................ERDLREVFSKYGPIADVSIQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDF.............. 88
61 -21.0002mju_A mol:protein length:207 Polypyrimidine tract-binding protein 2  ali model follow..  12  2...RVGMPGVSAGGNTVLLVSNL-NEEMVTPQ---------SLFTLFGVYGDVQRVKILYNKK-DSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQT......... 90
62 -20.9006g6s_A mol:protein length:95 Apoptotic chromatin condensation inducer in the nucleus  ali model follow..  13  1.........GSGKISNIVHISNLVRPFT-----------LGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWNPKFLCADYAEQDELDYHRGLLV 95
63 -20.8002i2y_A mol:protein length:150 Fusion protein consists of immunoglobulin G-Binding Protein G and Splicing factor, arginine/serine-rich 3  ali model follow..  26  81.......................................KTELERAFGYYGPLRSVWVAR-NPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR........ 144
64 -20.8002dh7_A mol:protein length:105 Nucleolysin TIAR  ali model follow..  30  1GSSGSSGQKKDTSNHFHVFVGDLSPEIT-----------TEDIKSAFAPFGKISDARVVKDKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPSGPSSG 105
65 -20.8001x4h_A mol:protein length:111 RNA-binding protein 28  ali model follow..  29  1GSSGSSGLPSDVTEGKTVFIRNL------------FDSEEEALGEVLQQFGDLKYVRVDTEHSKGCAFAQFMTQEAAQKCLAAASGLKLDGRQLKVDLAVTRDEAASGPSSG 111
66 -20.7002cpz_A mol:protein length:115 CUG triplet repeat RNA-binding protein 1  ali model follow..  28  39.......................................DQDLLQMFMPFGNVVSAKVFIDKSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG 115
67 -20.6003egn_A mol:protein length:143 RNA-binding protein 40  ali model follow..  10  40.........EPGEPNCRIYVKNL--AKHVQE---------KDLKYIFGRYVDFSSETQ-EGRMKGQAFIGLPNEKAAAKALKEANGYVLFGKPMVVQFARSAR......... 131
68 -20.6002lea_A mol:protein length:135 Serine/arginine-rich splicing factor 2  ali model follow..  20  27GSMSYGRPPPDVEGMTSLKVDNL------------YRTSPDTLRRVFEKYGRVGDVYIYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQM.............. 117
69 -20.6002dnz_A mol:protein length:95 Probable RNA-binding protein 23  ali model follow..  30  19.......................................EDMLRGIFEPFGKIDNIVLMKDRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGSGPSSG 95
70 -20.6002mzt_A mol:protein length:100 Protein HRB1  ali model follow..  18  7ARKFTENVVGGGERNRLIYCSNL------------FSTAKSDLYDLFETIGKVNNAEL-KGAPTGIAVVEYDNVDDADVCIERLNNYNYGGCDLDISY.............. 96
71 -20.6002err_A mol:protein length:109 Ataxin-2-binding protein 1  ali model follow..  26  37.......................................DPDLRQMFGQFGKILDVEINERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV......... 102
72 -20.5004pkd_B mol:protein length:279 U1 small nuclear ribonucleoprotein A,U1 small nuclear ribonucleoprotein 70 kDa  ali model follow..  24  1.......GVPETRPNHTIYINNL--NEKIKKD-----ELKKSLYAIFSQFGQILDILVSRSKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD........ 91
73 -20.5001wey_A mol:protein length:104 calcipressin 1  ali model follow..  13  2...........SSGSSGLIACVA--NDDVFSES----ETRAKFESLFRTYDKDTTFQYFKS---KRVRINFSNPLSAADARLRLHKTEFLGKEMKLYF.............. 80
74 -20.5002e5h_A mol:protein length:94 Zinc finger CCHC-type and RNA-binding motif-containing protein 1  ali model follow..  28  30.......................................NNDLYRIFSKYGKVVKVTIMKDKSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASI.............. 92
75 -20.5002mzq_A mol:protein length:101 Single-strand telomeric DNA-binding protein GBP2  ali model follow..  23  8AAKFTEGVNPGGDRNCFIYCSNL------------FSTARSDLFDLFGPIGKINNAELKPQEPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISY.............. 97

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24