current user: public

If you have questions about the server, please let us know.

Query: 2dkj_A mol:protein length:407 serine hydroxymethyltransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MVSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMPLast
1 -123.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model  100  1MVSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP 407
2 -119.0005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  57  7.ISISEFDPELAQAIASEDERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEFVDVIEQMAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQYGLNAETGEIDYEEVERLALEHKPRMIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKANEIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVVSGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGDADVKAKVEAVCAKFPVY 417
3 -118.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  58  6.NNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNQQVLNEVTKLIELFPFY 419
4 -115.0003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  58  11.QSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSRDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTQRVRREIFALCERFPI. 424
5 -115.0004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  57  6.MNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITPETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKANAIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDTAVKVKVAALCKACPVY 420
6 -114.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  64  4MSYITKQDKVIAEAIEREFQRQNSNIELIASENFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTESIAIDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYNFVEYGVDKDTERINYDEVRKLALEHKPKLIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYK-KDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVKGSILTGKEAEETLDSVGITCNKNTIPFDQEKPFVTSGIRLGTPAATTRGFDEKAFEEVAKIISLALKNSKDQQAKERVAKLTAEYPL. 413
7 -114.0005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  54  5.YFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVN-LDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTNEHAHPFPHCHVVSSTTHKTLRGPRGGIILTNDEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINNLHVKEELKAMANQFPVY 413
8 -114.0003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  54  4.MSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFY-GVELDGRIDYEKVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRGGIIMTNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNNENIKQELKKLASNFIIY 412
9 -113.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  58  12.EDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVSGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKERIRGDVKVLTDAFPL. 421
10 -113.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  59  6.MNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGID-ATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDERIKGKVLDICARYPVY 416
11 -112.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  60  18.APLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQ-QYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKAGGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALATGSSSALKDRATRLARAFPLY 430
12 -111.0001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  65  1MKYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFA-KQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGSEEARQRVAALTDPTSR. 409
13 -109.0001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  48  18.QPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEMLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKIFFESMPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKYELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYKIVTGGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-KSALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELTLQATLREEVENFASNFSLP 473
14 -108.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  58  9QSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINS-AIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDERVRAQVAELTKRFPV. 416
15 -108.0006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  49  14.QPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTSATSIFFNSMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-RSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQQALREEVESFASLFPLP 468
16 -108.0001bj4_A mol:protein length:470 PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)  ali model follow..  49  14.QPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-RSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQQALREEVESFASLFPLP 468
17 -108.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  57  9.MNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGID-ESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDERVKAKVLDICARFPVY 419
18 -108.0005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  48  25QESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVTSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGD-RSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEANLRQRVEQFARAFPMP 478
19 -108.0005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  46  16.GHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTSAVSTYFETMPYRVDLETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYKLVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGD-RSALVPGGVRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKTQLKNEISAWAGEFPLS 469
20 -103.0004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  42  5.EPLEQIDKELHDILADEEKRQRETINLIASENLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDFIDKIEELCQKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDMFESCNSQGYVDLDAVREMALSFKPKVIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACNILNNPFLHADVVTTTTHKILRGPRSALIFFNKKGIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQIDLVTNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDV-DCVSPSGVRIGTPAMTTRGAKEKDMEFIADVLARAIKITVDQQLKQEVVTWAGALPFP 442
21 -103.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  48  30QESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSSATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGD-RSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEANLRQRVEQFARAFPMP 483
22 -102.0006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  48  7.YGLSEADPDVHAIINKEKDRQFRSLELIASENFTSKAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELEILCQQRALAAFDKWGVNVQPLSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMTSGTSIYFESMPYRLDESTGVIDYDMLEKTAALFRPKLIIAGASAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAASVLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDAVESAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLVSGGSDNHLVLVDLRPSGIDGARVEKILDMASITLNKNSVPGD-KSALVPGGIRIGSPAMTTRGLGEKEFELIADLIHEGVRISLESNLRRKVEALATQYPIP 453
23 -102.0004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  44  37.DPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDLFESKLSEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILRGPRSALIFFNKKGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLVTNGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDV-DCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILLTDEDELKKEVVQWAKNLPF. 473
24 -101.0004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  34  1.MEYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLEGAEYLMGSTHKTFFGPQGGVILTTK-ENADKIDSHVFPGVVSNHHLHHKAGLAIALAE-MLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIIDIEFSASELAKMYEEANIILNKNLLPWDDNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEKEKVREDVKEFAKEYSTI 413
25 -101.0001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  50  23.QPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEHIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-KSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQRALRQEVESFAALFPLP 478
26 -21.2005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  16  32.....DINLDKYKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRL---DEVTCPPIKDFLEDIAKFLNMDCARP-THGAREGKFIVMHAICKEGDYVVLDKNA---HYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNKNVGLILLTDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE----KADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFLGCTSRGLPIVTLMASFPHVVER--VKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKF---------ETPVLDEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKMSVYGLEWEQVEYVVNAIKEIVE..................... 408
27 -21.1002hzp_A mol:protein length:501 Kynureninase  ali model follow..  13  69LRHFREKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESI-VGLMKDIVGANEKEIALMNALTVNLHLLMLSFPKRYKILLEAKAFSDHYAIESQLQLHGLNIEESMRMIEETLRIEDILEVIEKEGD-SIAVILFSGVHFYQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD----GVDFACWCSYKYLNAGAGGIGAFIHEKHAHTIKPALVGWFISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKRN----------PNGIRVAPVPLYN---SFHDVYKFTNLLTSILDSAETKN............... 495
28 -20.7003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  4CEARRAHEHLIRLLLEQGKCPEDG------DESTLELFLHELAVMDSNNFLGNCGVGERKAAGSSLLNKITNSLVLKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPECLHSTTACFA---RLEELAVICANYDIPHVVNNAY--GLQSSKCMHLIVGRIDAFVQSLDKNFMVPGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNA----AAAIGMKMQDVDLFIKRLDKCLNIVRKEQTRA............ 450
29 -19.7002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  15  54....................................................................PIHDFIHNQLPKFLGCDVARV---GAREAKFAVMHSLAKKDAWVV---MDENCHYSSYVAAERAGLNIALVPKTDYPD-YAITPENFAQTIEETKKRLITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE----GADFIVGSGHKSMAASGPIGVMGMKEEWAEIVKNKEVELLGCTARGATIITLMASFPHVRERIKRW--DEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEV-GGRFFLYRELKSRKIHGIKPGLT--------------RYFKLSTYGLSDEEVDYVLNAFKEIIEK.................... 369
30 -19.4002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  52IPENGIDDEKIKLFLKFLSMMDTDKDPKSVRIGEREARTYSKIHEELSSGFCHGVDPQPKASGASIMYALTNKILESFFKQLGVHAIATPISTGMSISLCLSAARKKYGSNVVIYPYA--SHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEIELCVLSTLTFFPP--DIVEIAKICENYDIPHIINGAY--AYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGLVYSTDAEFIKEISLS----YPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDY---IVMNAAIGVRTEDIVNSVSKLEKIL...................... 449
31 -19.3003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  17  50.....................ANNYLGLADHPALIKTAQTVV------EQYGFGMASVRFICGTQ---TIHKELEKDISEFLGTDDTIL---SCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYK-------------AMGDLEAKLKEARFKLIATDGSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENEYCGVADRVDILTGTLGKALGGASGGYT-SGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNH---PIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMG---KARIRVQMSA----VHTQQQLDRAIEAFGQVGKK.................... 395
32 -19.1001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  15  46.....................SNDYLGLSHHPQIIRAWQQGA------EQFGIGSGGSGHVSGYS---VVHQALEEELAEWLGYSRALL---SGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFA-------------DVTHLARLLASPCPGQMVVTEGVFSMD-PLAEIQQVTQQHNGWLMVDDAHGTGVIGRGSCWLQKVKPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCS---AIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAG---TARLRLTLTA----AHEMQDIDRLLEVLHGN....................... 383
33 -19.1005i90_A mol:protein length:427 PvdN  ali model follow..  16  30.EGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRN-PGEAVDWHREEIWKYEDEARAWAGRYFAVQPGQV-TGSTTDGLAAIYGGLVQPGKEILTSSHEHYSTYTLEYRHKRMGTQVREFPLFKDPHRVSADLSSIAAQIRP-QTRVLGMTWVQSGVKLPIREIGKLVRELNQIYVVDGVHGFGVEDVSFAD----DCDYFIAGTHKWLFGPRGGVIIARSEQLQEHLVPSIPTFSRGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHKVRLVTPSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVD---------VGPVVRLAPSLLN----DEAEIDRVLEILAPQL...................... 426
34 -18.9001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  15  46......DELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLHPYQDPRTAQGALRLMWEL-GEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHED--VVLVPDSAHGSNPATASMAGYQVREIPS---GPEGEVDLEALKRELGPHVAALMLTNPNTLLFERRILEISRLCKEAGVQLYYDGANLNAIMG--WARPGDMGFDVVHLNLHKTF-GPGSGPVGVKAHLADFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQ------PPEGFRALDLAKGLLELGFHPPTVYFPLIVKEALMVEPTETE----AKETLEAFAEAMGALLKKPKEW................ 444
35 -18.6001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  14  8.LALDAQDS--LAPLRQQFALPEGVIYL-NSLGARPVAALARAQAVIAEEWGNGLIR--SWNSAGWRDLSER-LGNRLATLIGARDGEVVVTDTTSINLFKVLSAAPERRVIVTETSNFTDLYIAEGLADMLQQGYTLRLV--------DSPEELPQAIDQ-DTAVVMLTHVNYKYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ----GADYAIGCTYKYL-GPGSQAFVWVSPQLCDLVPQPLSGWFCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRELTLVTPREHAKRGSHVSFEHP-EGYAVIQALIDRGVIGDYRE----------PRIMRFGFTPLYT---TFTEVWDAVQILGEILDRKTWAQAQFQVRH........ 413
36 -18.6003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  15  2MRNMQEKGVSEKEILEELKKYRSLDLKYEDGNGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTK---LLEEKAVALLGSLLNNKDAGHIVSGGTEANLMALRCIKNSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPI---KEDYTIDEKFVKDAVEDYDVDGIIAGTTELGTIDNIEELSKIAKENNIYIHVDAA-FGGLVIPFLDDKYKLGVDSITIDPHKMGHCPIPGGILFKDIGYKRYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPI-----LNIVAIEDEDYKEVCKKLRDRGIYVSVCN---------CVKALRIVVMPHIKREHIDNFIEILNSIKRD........................ 397
37 -18.5005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  15  26......................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVIDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQHCPKKKL.............. 397
38 -18.5002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  46.....................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNN-EVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTIRSE----SQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY.................... 383
39 -18.5001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  17  52.....................ANNYLGLANHPDLIAAAKAGM------DSHGFGMASVRFICGTQ---DSHKELEQKLAAFLGMEDAIL---SCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYA-------------DMQELEARLKEAREHVLIATDGVFSMD-NLKGVCDLADKYDALVMVDDSHAVGFVGENEYCDVMGRVDIITGTLGKALGGASGGYT-AARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGADH---AIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKG---QARIRTQMSA----AHTPEQITRAVEAFTRIGKQ.................... 396
40 -18.3005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  13  7................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS----EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVIC---SETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHC---AQLLALLVSDLPGVELMFPVEANGVFLQM------PEHAIEALRAKGWRFYTFI---------GSGGARF----MCSWDTEEERVRELAADIRSIITA.................... 346
41 -18.2003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  60.....................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNN-EVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTIRSE----SQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY.................... 397
42 -18.2002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  18  10............................LRSDTVTKP------TEEMRKAMAQAEVGDDVYGEDPTINELE----RLAAETFGKEAA-LFVPSGTMGNQVSIMAHTQRGDEVIL---EADSHIFWYEVGAMAVLS--VMPHPVPGKNGAMDPDDVRKAIRPPRTSLIAIENTRVVPLENIKEICTIAKEHGINVHIDGARIFNASIA--VKEYAGYADSVMFCLSKGLCAPVGSVVVGDRD-----IERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKED--ENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANA----------VSDTEIRL----VTHKDVSRNDIEEALNIFEKLFRK.................... 347
43 -18.2005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  11  24.AQTVTGPLPFGNSLLKEFVLDPAYRNL----NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPVETVNATMGVNTVLRNIVWSADGKDEILYFDTIYGACIDYVIEDKRGIVSSRCIPLIYPAEDDDV-VAAFRDAIKKSRPRLAVIDSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITE----DPDFLISNCHKWLFTPRGCAVFYVPVRNQHLIRSTLPTSFVGTVDNSPFFCVAIKWREEVLGGEERIMEYMTKLAREGGQKVAEIGTRVLENSTGTLIRCAMVN-YEIPHEEANMAFKWMYNVLDEFNTFVPMTFHRRRFWARLSAQVYL----EMSDFEWAGKTLKELCERVAKGEYKESALE........ 482
44 -18.1003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  15  22......................PTRLLLGPGPSNLAPRVLAAGSLRMIGHMQ------------KEMLQIMEEIKQGIQYVFQTRNPLTLVVSGHCAMETALFNLLEPGDSFLTGT---NGIWGMRAAEIADRIGARVHQMIKKPGE-HYTLQEVEEGLAQHKPVLLFLGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLG---GVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKVIHHTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVTVPAGRDIVSYVLDHFSIEI------SGGLGPTEERVLRIGLLGYN---ATTENVDRVAEALREALQHCPKNKL.............. 393
45 -18.1001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  15  17................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAA----RLIGELLERPDADV-ISGGTQTNLIACSLALRPWEAVIA---TQLGHISTHETGAIEATGHKVVTAP--CPDGKLRVADIESALHENIPKLVYISNTTQYTKQELEDISASCKEHGLYLFLDGARLASALSS-TLADIARLTDMFYIGATKAGGMFGEALIILND----ALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNFFELGAHSNKMAAILKAGLEACGIRLAWPSASN---QLFPILENTMIAELNNDFDMYTVEPLKDG----------TCIMRL----CTSWATEEKECHRFVEVLKRLVASTA.................. 359
46 -18.1005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  15  48.....................SNDYLGLAAHPQLIAAIAEGA------QRYGAGSGGSHLLGGHS---RAHAQLEDDLAEFVGGFVENARALTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYP-------------DTDALSAMLEASDADKVIVSDTVFSMD-PLPRLLELAEQHGAWLIVDDAHGFGVLGPQAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHT---AVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTG---TSRLRISLSA----AHSQADLDRLEAGLQQLGAK.................... 394
47 -18.0004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  16  23......................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVAFLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVIDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQHCPKKKL.............. 394
48 -18.0002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  14  136....QQLLPPLFSALMKYSDIHEYSWAA-PGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLD-SEKYAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---VDRNCHKSIEQGLMLTGAKPVYMVPSRNRYPQEMQPETLQKKISESKPSYCVVTNCTY---YNAKEAQDLLEKTSDRLHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR............................................................................................................ 463
49 -18.0004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  15  21......................PNQLLLGPGPSNLPPRIMAAGGLQMIGHMS------------KEMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVMDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQHCPKKKL.............. 392
50 -18.0003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  22CEARRSHEHLIRLLLEKGKCPENHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGGSSLLNKITNSLVLDIIKLAGVHTVANCFVMSLTLCFLTLRHKRPKAKYII---WPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCIHSTTSCFA-PDRLEELAVICANYDIPHIVNNAY--GVQSSKCMHLIQQRIDAFVQSLDKNFMVPVGGIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKT.... 476
51 -18.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  18  50.....................SNSYLGLTTDTRIIKAAQDAL------EKYGTGCAGSRFLNGTL---DIHVELEEKLSAYVGKEAAIL---TGFQSNLGPLSCLMGRNDYILL---DERDHASIIDGSRLSFSKVIKYGHN--------NMEDLRAKLSRLPEKLICTDGSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKSHFGLNDDVDLIMGTFSKSL-ASLGGFV-AGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDLGATESP---ILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAE---ESLIRFSLMA----THTYDQIDEAIEKMVKVFKQAEVETL.............. 397
52 -18.0005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  13  95..................................................................TAEIENRCVNIIANLWHASFTGTSTIGSSEACMLAGLAMLDLTAHQPNIVISAGYQVCWEKFCVYWDIDMHVV--PMDDDHMSLNVDHVLDYVDDYTIGIVGIQYDDLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELLNNVISINASGHKYGLVYPGGWVIWRDQQYLPK-GELPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGFSLINDGHELPLICYELTADSDREWTLYDLSDRLLMKGWQVPTYPLPKNMTDRVIQRI----VVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSDPQPKKYGF. 466
53 -17.9005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  18  46.....................SNDYLGLAAHPKLVAAFAEGA------QRYGSGSGGSHLLGGHS---RAHAKLEDELAGFAGGFSDAPRALTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYP-------------DTATLGALLEACQTKLIVTDTSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEGDARRAHLAALIERTRALLRRTRWQPVDSHT---AVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAG---TSRLRISLSA----AHSFDDLARLETALLRASEE.................... 392
54 -17.7001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  11  103...EDSILPPFFKSLKEYVSRYLIQFDC-PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLI-AEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVL---FDRNNHKSVYNSALAMAGGRPVYLQTNRNPYGFIDSDFDEKKIRELAAKAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRNPEDPGIIVVQSVHKQQAGSQTSQIHKKDSHIKKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAKWHAYEGYGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGIIPEKSDLNSILFLMTP. 545
55 -17.7002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  15  51.....................TYNYMGMTFDPDVIAAGKQAL------DEFGSGTTGSRVLNGTY---QGHKACEDALKEFYGTEHAIV---TGYQANLGMISTLAGKGDYIIL---DADSHASIYDGCWLGDAEIVRFRHN--------SVEDLDKRLGRLPAKLVVLEGSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHEEAGVEADVDFVVGTFSKSV-GTVGGFC-VSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHA-GDKRAHLWKNSRRLHQGLRDMGYKL-GTETAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAG---MFLLRCSLCAE-----SDEQVEQILGMFESAGRATGVIPKLAAALE........ 406
56 -17.7001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  10  4...........ITPSLHQFPGLANKTYF--NFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTDIVLWGLDWHQGDEILLTDCEHPGIIA-QAIAARFGITYRFFPVA-ATLNQGDAAAVLANHLGP-KTRLVILSHLLWNQVLPLAEIMAVCRRHQVRVLVDGAQSAGSLPLDFSR----EVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPTYVGW-VATSAYPQYAGLLAALQLHQRQGTAERYQAICQRSEFLWRGLNQPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYL---------RTIADPDCIRACCHYIT----DEEEINHLLARLADF....................... 388
57 -17.6002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  15  17......................PEKIMMGPGPSNCSKRVLTAMTNTVLSNFH------------AELFRTMDEVKDGLRYIFQTENRATMCVSAHAGMEAMLSNLLEEGDRVLIAV---NGIWAERAVEMSERYGADVRTIEGPPDR-PFSLETLARAIELHQPKCLFLGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLC---GVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHRLPTVTGIMIPKGWKVSQYAMNNFSLEV------QGGLGPTFGKAWRVGIMGECS---TVQKIQFYLYGFKESLKA.................... 382
58 -17.6002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  15  21......................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVMDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALVA.................... 386
59 -17.6003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  17  4............................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRERNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRD-----IKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQED--DNAAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSREQLAEVAAHWRAFLAR.................... 333
60 -17.6002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  14  61......................................................................EKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYL-PELPGHPSIERSCKIVNAKYFESD----------KVGEILNKIDKDTLVIITGSTMDLIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKGADLVVTSTDKLMEGPRGGLLAGKKELVDKIYIEGTKFGLEAQPP--LLAGIYRALKNFNLERIRKAFERAKNFDLSKIEKLNKELINIVYERTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYIKAIVESIKMAFKS.................... 374
61 -17.5004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  14  52.....................TSDYLNLSSAHNLKHAIVNGF------DKYGFGSKGSNIVCGYT---DETQQFEHEFAKFINYPRAIF---SGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYK-------------QLSQLQDIYDGKS---FITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLGINSFRISYKNCLICVFPLGKAF-GGVGAVVCT-TEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV-NDNRARLQQNITFFNELCDAKDLELVSK--DLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKD---QAILRFSLHSN-----TFDQIQQALEIISKEVKY.................... 387
62 -17.5001v72_A mol:protein length:356 Aldolase  ali model follow..  14  11................................GFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVK----RKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWGNIYC---HPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKQPACVSITQASIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVS-AEMTWKAGVDALSFGATKNGVLAAEAIVLFNT----SLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSAMIDALLKAGFGFYH---------------RWGPNVVRF----VTSFATTAEDVDHLLNQVRLAADRTQER................ 356
63 -17.4002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  15  18......................PNKLLMGPGPSNAPQRVLDAMSRPILGHLH------------PETLKIMDDIKEGVRYLFQTNNIATFCLSGHGGMEATLCNLLEDGDVILIGH---TGHWGDRSADMATRYGADVRVVKSKVGQ-SLSLDEIRDALLIHKPSVLFLGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLG---GAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKVPQGWLKAAQYAMKTYLVEI------SGGLGPTAGQVFRIGLMGQN---ATTERVDRVLQVFQEAVAA.................... 382
64 -17.4001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  16  1MAKVEPFRIKMVEKIRVPSREERNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLK----DKAKELFNYDYI-IPAHQGRGAENILFPVLLKYKQKEGKFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKGDFDIKKLKENIAQHGADNIVAAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYP-TGGHAVFVDCKKLVPQ-AVINALYLESGVRAVEIGSFLLGRDPATGE-MRLTIAR-----YTNDHMDYIADALIGLKEKFATLK-PPVLRHFTARLPI. 466
65 -17.3002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  17  71.....................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN--------SVEDLDKRLGRLPKKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSKSV-GTVGGFV-VSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRL-GTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICA----EHTPAQIQTVLGMFQAAGRA.................... 414
66 -17.3005xx1_A mol:protein length:756 Arginine decarboxylase  ali model follow..  13  137....QQLLPPLFNALMKYSDIHEYSWAA-PGHQGGVGFTKTPSGRFYHDYYGENLFRSDMGIERTTLGSLLD-SEKNAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---LDRNCHKSIEQGLILTGAKPVYMVPSRNRYPQEMQPETLQKKISASKPSYSVVTNCTY---YNAKEAQDLLAKTSDRIHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR............................................................................................................ 464
67 -17.3003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  12  32MPENSIPKEAAYQIINDELMLDGN--LASFVTTWMEPECDKLIMSSINKNYVD-------MDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGSSEAIMLAGLAFKRKWQNKRKAEGVQVCWEKFARYFE--VELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEVKLLNDLLVEKNKETGWDT-HVDAASGGFIAP--LPLVKSINVSGHKYGLVYAGGWVIWRNKEDLPE-ADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSLKSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITV---LRVVIREDFSRTLAERLVIDIEKVMRELDELPSR................. 450
68 -17.1004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  4............................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRD-----IKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQED--DNTAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSRAQLAEVAAHWRAFLAR.................... 333
69 -17.1004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  17  87.....................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN--------SVEDLDKRLGRLPKKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSASV-GTVGGFV-VSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRL-GTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICA----EHTPAQIQTVLGMFQAAGRAVGVIGL.............. 436
70 -17.0001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  17  34.......................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTAAHGIKVFYDATRCVENAYAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIVEP-VGGHAVFLDARRF------------CEHLTQDEFPAQSLAASIYVETGVRSPKLETVRLTITYAHMDVVADGIIKLYQHKEDIR-PKQLRFFTARFYI. 456
71 -17.0004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  14  64.LSSSAVLEKLKEYSSMDAFWQEGRATVYSGEEKLTELLVKAYGDFAWSNPLH-------PDIFPGLRKIEAEIVRIACSLFNGDSCGCVTSGGTESILMACKAYFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPL---TKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDVPEVAKLAVKYKIPLHVDAC-LGGFLIVFMEKA-VKGVTSISADTHKYGYAPKGSLVLYSDKKYRNY-GIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIGIFVFGNP---QLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP---------PSIHF---CITLLHARKRVAIQFLKDIRESVTQKAKTTGMGAIYGMAQTTV.. 476
72 -17.0003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  17  9............................LRSDTVTQP------TDAMRQCMLHAEVGDDVYGEDPGVNALE----AYGADLLGKEAA-LFVPSGTMSNLLAVMSHCQRGEGAVL---GSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDTPTRLVCLENTVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVA--VRELVAPFDSVSICLSKGLGAPVGSLLVGSHA-----IARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADD--RRARQLAEGLAALGIRLDLAQVQTNMVFLQLTSGES--APLLAFMKARGILFSGYGE------------LRL----VTHLQIHDDDIEEVIDAFTEYLGA.................... 341
73 -16.9003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  13  1.............MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFD------------PAFTGIMNETMEMLRELFQTKNRWAYPITSRAGIEAVLASVIEPEDDVLIPI---YGRFGYLLTEIAERYGANVHMLECEWGT-VFDPEDIIREIKKVKPKIVAMGETSTGRIHPLKAIGEACRTEDALFIVDAVATIG---GCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERG-TEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVTCVEIPGGGESVRDMLLAQFGIEI------ASSFGPLAGKIWRIGTMGYS---CRKENVLFVLAGLEAVLLRHNGIEAGKALQAALDVY... 407
74 -16.9001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  13  32FPLHEMRDDVAFQIINDELYLDGN---ATFCQTWDDENVHKLMDLSINKNWIDKEE-------YPQSAAIDLRCVNMVADLWHAPAVGTNTIGSSEACMLGGMAMAAGKPTDKPNLVCGPVQICWHKFARYWD--VELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEALDKFQADTGIDIDMHIDAA-SGGFLAPFVAPDILPRVKSISASGHKFGLAPLGGWVIWRDEEALPQ-GQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGYEFICTGRPDEGIPAVCFKLKDGEDDLSERLRLRGWQVPAFTLGGEATDIVV---MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQN.......... 461
75 -16.8002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  18  2.........................LLLTPGPTPIPERVQKALLRPMRGHLD------------PEVLRVNRAIQERLAALFDPGLVAALAGSGSLGMEAGLANL--DRGPVLVLV---NGAFSQRVAEMAALHGLDPEVLDFPPGE-PVDPEAVARALKRRRYRMVALGETSTGVLNPAEAIGALAKEAGALFFLDAVTTLG---MLPFSMRAMGVDYAFTGSQKCLSAPPGLAPIAASLEARKAFTGK---GYHHTTPVLLHYALLEALDLVLEEGVAARERRAREVYAWVLEELKARGFRPYPKASPLPTVLVVRPPEGVDADRLVRALYAEGVAV------AGGIGPTRGQVLRLGLMGEGA---RREAYQAFLKALDRALAL.................... 352

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.