current user: public

If you have questions about the server, please let us know.

Query: 2dny_A mol:protein length:119 Fuse-binding protein-interacting repressor, isoform b, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst GSSGSSGKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSASGPSSGLast
1 -81.0002dny_A mol:protein length:119 Fuse-binding protein-interacting repressor, isoform b  ali model  100  1GSSGSSGKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSASGPSSG 119
2 -74.5003ue2_A mol:protein length:118 Poly(U)-binding-splicing factor PUF60  ali model follow..  97  10....VMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA...... 118
3 -66.5002pe8_A mol:protein length:105 Splicing factor 45  ali model follow..  37  2........AMGKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGA---PDDEAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQ..... 104
4 -62.6002m52_A mol:protein length:105 Splicing factor U2AF 65 kDa subunit  ali model follow..  34  2...........GHPTEVLCLMNMVLPEELLDEIVEDVRDECSKYGLVKSIEIPRPVDG--VEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF........ 104
5 -60.1004fxw_A mol:protein length:106 Splicing factor U2AF 65 kDa subunit  ali model follow..  33  2..........PLGSTEVLCLMNMVLPEELLDEIVEDVRDECSKYGLVKSIEIPRPVDG--VEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDF........ 105
6 -56.5004ru2_A mol:protein length:114 RNA-binding protein 39 (RBM39)  ali model follow..  21  2.........VQPLATQCFQLSNMFNPQTEEEEIKDDVIEECNKHGGVIHIYVDKY--------SAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ. 107
7 -54.4002dit_A mol:protein length:112 HIV TAT specific factor 1 variant  ali model follow..  31  1GSSGSSGGPSRMRHERVVIIKNMFHPMDFEDEIREDLRVECSKFGQIRKLLLFDRHPD--------GVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQS.......... 107
8 -54.0004oz0_A mol:protein length:115 RNA-binding protein 39  ali model follow..  21  2........SVQPLATQCFQLSNMFNPQTEEEEIKDDVIEECNKHGGVIHIYVDKN--------SAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ. 108
9 -53.0005zoj_D mol:protein length:132 Inner nuclear membrane protein Man1  ali model follow..  16  13..HLDRRNSPPNSLTPCLKIRNMFDPVMEIGAIQEAILEKCSDNDGIVHIAVDKNSRE--------GCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNT. 125
10 -42.6001jmt_A mol:protein length:104 SPLICING FACTOR U2AF 35 KDA SUBUNIT  ali model follow..  23  1..............SQTIALLNIYRNPQNSDEFFEEVFTEMEEYGEVEEMNVCD-----NLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSP................. 104
11 -25.6006cmn_A mol:protein length:119 TAR-Binding Protein 6.7  ali model follow..  13  13...QGHMAVPETRPNHTIYINNL-NSKIKKDELKKSLHAIFSRFGQILDILVPRQRTPR-------GQAFVIFKEVSSATNALRSMQGFPFYDKPMAIQYAKTDK.............. 106
12 -25.5001wey_A mol:protein length:104 calcipressin 1  ali model follow..  11  2...........SSGSSGLIACVANDDVFSESETRAKFESLFRTYDKDTTFQYFK----------SFKRVRINFSNPLSAADARLRLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKS 99
13 -24.9005fj4_A mol:protein length:102 U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A  ali model follow..  13  2.......AVPETRPNHTIYINNL-NEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMR-------GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT..... 100
14 -24.8002cpi_A mol:protein length:111 CCR4-NOT transcription complex subunit 4  ali model follow..  22  12.................VVQKNLVFVVGLSQRLADP-PEYFGKFGKIHKVVINNSTSYAG-SQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASL................... 97
15 -24.7002fho_B mol:protein length:87 spliceosomal protein p14  ali model follow..  17  1...GRANIRLPPEVNRILYIRNL------YKITAEEMYDIFGKYGPIRQIRVGNTPETR-------GTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYN................. 87
16 -24.6002k3k_A mol:protein length:104 U1 small nuclear ribonucleoprotein A  ali model follow..  10  1.........MEMLPNQTIYINNL-NEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMR-------GQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKER. 101
17 -24.6006f4g_B mol:protein length:98 U1 small nuclear ribonucleoprotein A  ali model follow..  11  1.......GAMEMLPNQTIYINNL-NEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMR-------GQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKG...... 98
18 -24.6004pr6_A mol:protein length:95 U1 small nuclear ribonucleoprotein A  ali model follow..  13  3...........TRPNHTIYINNL-NEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMR-------GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMA....... 95
19 -24.5003jb9_k mol:protein length:111 Probable U2 small nuclear ribonucleoprotein B``  ali model follow..  16  2.............NQNTLYVNNL-NDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMR-------GQAHVVFFDPSAAAIAMKALKNFIFFGKEMKIQYAHSKS.............. 85
20 -24.3004yb1_P mol:protein length:92 U1 small nuclear ribonucleoprotein A  ali model follow..  15  1............RPNHTIYINNL-NEKIKKDELKKSLHAIFSRFGQILDILVKRSLKMR-------GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDS.............. 85
21 -24.2005gmk_a mol:protein length:111 U2 small nuclear ribonucleoprotein B``  ali model follow..  15  15..THHTVAEPVTEAKNTLYVSQL-NEKINMQRLRVNLFLLFATFGEVLKVSM--------NFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSKSET.............. 108
22 -23.6002e44_A mol:protein length:96 Insulin-like growth factor 2 mRNA binding protein 3  ali model follow..  21  1GSSGSSGSVPKRQRIRKLQIRNI--PPHLQWE---VLDSLLVQYGVVESCEQVNTDSET-------AVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEM.............. 93
23 -23.5002a3j_A mol:protein length:127 U1 small nuclear ribonucleoprotein A  ali model follow..  14  16.SPDLGSTPPHTEPSQVVLITNI-NPEVPKEKLQALLYALASSQGDILDIVVDLSDDNS-------GKAYIVFATQESAQAFVEAFQGYPFQGNPLVITFSETPQ.............. 111
24 -23.0001wex_A mol:protein length:104 HYPOTHETICAL PROTEIN (RIKEN CDNA 2810036L13)  ali model follow..  23  1GSSGSSGSHHKVSVSPVVHVRGL--CESVVEA---DLVEALEKFGTICYVMMMPFK----------RQALVEFENIDSAKECVTFAADVYIAGQQAFFNYSTSKRITR........... 95
25 -23.0002f9d_A mol:protein length:125 Pre-mRNA branch site protein p14  ali model follow..  16  5.AAKRANIRLPPEVNRILYIRNL------YKITAEEMYDIFGKYGPIRQIRVGNTPETR-------GTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANR.............. 96
26 -22.8005ev1_A mol:protein length:201 Splicing factor U2AF 65 kDa subunit  ali model follow..  17  105.YVPGVVSTVVPDSAHKLFIGGL--PNYLNDD---QVKELLTSFGPLKAFNLVKDSATG----LSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVG............... 198
27 -22.5002rra_A mol:protein length:99 cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Homo sapiens transformer-2-beta (SFRS10) gene  ali model follow..  24  1GSSGSSGNRANPDPNCCLGVFGLSLYTT-----ERDLREVFSKYGPIADVSIVYDQQSR----RSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDF................... 91
28 -22.5002cq0_A mol:protein length:103 Eukaryotic translation initiation factor 3 subunit 4  ali model follow..  23  1GSSGSSGPNRRADDNATIRVTNL------EDTRETDLQELFRPFGSISRIYLAK----DKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEW................... 91
29 -22.4002dgx_A mol:protein length:96 KIAA0430 protein  ali model follow..  15  1......GSSGSSGNGADVQVSNI-DYRLSRKELQQLLQEAFARHGKVKSVELSP-------HTDYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSL................... 86
30 -22.4002cqc_A mol:protein length:95 Arginine/serine-rich splicing factor 10  ali model follow..  23  1GSSGSSGNRANPDPNCCLGVFGLSLYTT-----ERDLREVFSKYGPIADVSIVY----DQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVSG................... 91
31 -22.3005mqf_X mol:protein length:225 U2 small nuclear ribonucleoprotein B``  ali model follow..  18  1.........MDIRPNHTIYINNM-NDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMR-------GQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQY................... 83
32 -22.2002cq1_A mol:protein length:101 PTB-like protein L  ali model follow..  21  1GSSGSSGDKMDGAPSRVLHIRKL--PGEVTET---EVIALGLPFGKVTNILMLKGK----------NQAFLELATEEAAITMVNYYSAVHLRNQPIYIQYSNHKELKTSGPSS...... 100
33 -22.1002yh0_A mol:protein length:198 SPLICING FACTOR U2AF 65 KDA SUBUNIT  ali model follow..  17  101.YVPGVVSTVVPDSAHKLFIGGL--PNYLNDD---QVKELLTSFGPLKAFNLVKDSATG----LSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVG............... 194
34 -22.0003lqv_A mol:protein length:115 Pre-mRNA branch site protein p14  ali model follow..  17  1.......IRLPPEVNRILYIRNL------YKITAEEMYDIFGKYGPIRQIRVGNTPETR-------GTAYVVYEDIFDAKNAVDHLSGFNVSNRYLVVLYYNANR.............. 86
35 -21.9001wf2_A mol:protein length:98 Heterogeneous nuclear ribonucleoproteins C1/C2  ali model follow..  21  1GSSGSSGKTDPRSMNSRVFIGNL----NTLVVKKSDVEAIFSKYGKIVGCSVHK------------GFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPK.............. 89
36 -21.9002wbr_A mol:protein length:89 GW182  ali model follow..  20  3..........MAWGSSWLLLKNL--TAQIDGP---TLRTLCMQHGPLVSFHPYLNQ----------GIALCKYTTREEANKAQMALNNCVLANTTIFAESPSENEVQS........... 85
37 -21.7002mtg_A mol:protein length:119 La-related protein 6  ali model follow..  15  6.............PSKMLLVYDLYLSPK-QEKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSAIVEFEEVEAAIKAHEFMITESQGKENMKAVLI.................. 115
38 -21.7002cph_A mol:protein length:107 RNA binding motif protein 19  ali model follow..  30  1GSSGSSGQVPKKQTTSKILVRNI-------QANQREIRELFSTFGELKTVRLPKKMTGTGAHR---GFGFVDFITKQDAKKAFNALHSTHLYGRRLVLEWADSEV.............. 98
39 -21.6003to8_A mol:protein length:218 Heterogeneous nuclear ribonucleoprotein L  ali model follow..  21  3.............DSPVLMVYGL-DQSKMNCD---RVFNVFCLYGNVEKVKFMKSKP---------GAAMVEMADGYAVDRAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGS. 94
40 -21.6002cqi_A mol:protein length:103 Nucleolysin TIAR  ali model follow..  23  1GSSGSSGMMEDDGQPRTLYVGNL--SRDVTEV---LILQLFSQIGPCKSCKMITEHTSND------PYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPS.............. 94
41 -21.5002dk2_A mol:protein length:97 Heterogeneous nuclear ribonucleoprotein R  ali model follow..  27  1GSSGSSGDPEVMAKVKVLFVRNL------TTVTEEILEKSFSEFGKLERVKKLK------------DYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVL................... 83
42 -21.5001whw_A mol:protein length:99 hypothetical protein RIKEN CDNA 1200009A02  ali model follow..  16  5...........SSGSGRLFVRNL-------TSSEEDLEKLFSAYGPLSELHYPI----DSLTKKPKGFAFVTFMFPEHAVKAYAEVDGQVFQGRMLHVLPSTIKK.............. 89
43 -21.4002mqn_A mol:protein length:216 Heterogenous nuclear ribonucleoprotein L  ali model follow..  23  5...........HADSPVLMVYGL-DQSKMNCD---RVFNVFCLYGNVEKVKFMKSKP---------GAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPA.............. 85
44 -21.2002dnm_A mol:protein length:103 SRp46 splicing factor  ali model follow..  19  2...SSGSSGPDVDGMITLKVDNLTYRTS-----PDSLRRVFEKYGRVGDVYIPR----EPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGR.............. 94
45 -21.1003egn_A mol:protein length:143 RNA-binding protein 40  ali model follow..  11  34...SVFRSYEPGEPNCRIYVKNL--AKHVQEK---DLKYIFGRYVDFSSETQRIMFD-LMKEGRMKGQAFIGLPNEKAAAKALKEANGYVLFGKPMVVQFARSAR.............. 131
46 -21.1002adc_A mol:protein length:229 Polypyrimidine tract-binding protein 1  ali model follow..  18  14HMGRIAIPGLAGAGNSVLLVSNL-NPERVTPQ---SLFILFGVYGDVQRVKILFNKK---------ENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQN.............. 105
47 -21.1002cpj_A mol:protein length:99 Non-POU domain-containing octamer-binding protein  ali model follow..  24  1GSSGSSGGEKTFTQRSRLFVGNL--PPDITEE---EMRKLFEKYGKAGEVFIHKDK----------GFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRF................... 85
48 -21.0002mju_A mol:protein length:207 Polypyrimidine tract-binding protein 2  ali model follow..  20  1GRVGMPGVS--AGGNTVLLVSNL-NEEMVTPQ---SLFTLFGVYGDVQRVKILYNKK---------DSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQT.............. 90
49 -21.0002x1f_A mol:protein length:96 MRNA 3`-END-PROCESSING PROTEIN RNA15  ali model follow..  20  1.............PSRVVYLGSI-------DQTEEQILDLCSNVGPVINLKMMFDPQTG----RSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSD.............. 83
50 -21.0002e5h_A mol:protein length:94 Zinc finger CCHC-type and RNA-binding motif-containing protein 1  ali model follow..  18  2SSGSSGMSGGLAPSKSTVYVSNL--PFSLTNN---DLYRIFSKYGKVVKVTIMKDKDTR----KSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASI................... 92
51 -21.0002cpx_A mol:protein length:115 Hypothetical protein FLJ11016  ali model follow..  16  22...........GEPNKVLYLKNL------PRVTERDLVSLFARFQEKKGPPIQFRMMTGRMR----GQAFITFPNKEIAWQALHLVNGYKLYGKILVIEFGKNKK.............. 106
52 -21.0003r27_A mol:protein length:100 Heterogeneous nuclear ribonucleoprotein L  ali model follow..  17  2.GMENYDDPHKTPASPVVHIRGL------DGVVEADLVEALQEFGPISYVVVMPKK----------RQALVEFEDVLGACNAVNYAADNYIAGHPAFVNYSTSQKIS............ 94
53 -21.0002cpf_A mol:protein length:98 RNA binding motif protein 19  ali model follow..  19  2...........SSGSSGLFIKNL-------STTEETLKGVFSKVGAIKSCTISKKKNKAGVLLS-MGFGFVEYKKPEQAQKALKQLQGHTVDGHKLEVRISERAT.............. 89
54 -21.0002rrb_A mol:protein length:96 cDNA FLJ40872 fis, clone TUTER2000283, highly similar to Homo sapiens transformer-2-beta (SFRS10) gene  ali model follow..  19  1...GPLGSRANPDPNCCLGVFGLSLYTT-----ERDLREVFSKYGPIADVSIVYDQQSR----RSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDF................... 88
55 -20.9003pgw_A mol:protein length:282 U1-A  ali model follow..  12  1......MAVPETRPNHTIYINNL--NEKIKDELKKSLYAIFSQFGQILDILVSRSLKMR-------GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVER. 104
56 -20.9001sjq_A mol:protein length:105 Polypyrimidine tract-binding protein 1  ali model follow..  16  7...........GVPSRVIHIRKL--PIDVTEG---EVISLGLPFGKVTNLLMLKGK----------NQAFIEMNTEEAANTMVNYYTSVVLRGQPIYIQFSNHKELKT........... 90
57 -20.9002n3l_A mol:protein length:89 serine/arginine-rich protein 1, PfSR1-RRM1  ali model follow..  28  24.................................SRDVENEFRKYGNILKCDVKKTVSGA-------AFAFIEFEDARDAADAIKEKDGCDFEGNKLRVEV................... 83
58 -20.9005d77_A mol:protein length:82 RNA-binding protein MIP6  ali model follow..  20  2..........PLGSMKTILVKNL------SDTTQEEVLDYFSTIGPIKSVFISEKQANTP------HKAFVTYKNEEESKKAQKCLNKTIFKNHTIWVGP................... 80
59 -20.8001ufw_A mol:protein length:95 Synaptojanin 2  ali model follow..  24  1GSSGSSGSSFQGPLDATVVVNTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQ------------GQMLVTFADSHSALSVLD-VDGMKVKGRAVKISG................... 91
60 -20.8001whx_A mol:protein length:111 hypothetical protein RIKEN CDNA 1200009A02  ali model follow..  20  1.....GSSGSSGRSKTVILAKNL------AGTLAAEIQETFSRFGSLGRVLLPEGG----------ITAIVEFLEPLEARKAFRHLAYSKFHHVPLYLEWAPIGVFGAAPQKKDSQHE. 98
61 -20.8002cpd_A mol:protein length:99 APOBEC-1 stimulating protein  ali model follow..  24  1GSSGSSGDEDTMSSVKILYVRNL------LSTSEEMIEKEFNNIKPGAVERVKKIR----------DYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL................... 85
62 -20.8005gvq_A mol:protein length:105 Splicing factor 3B subunit 4  ali model follow..  18  1GSSGSSGPISERNQDATVYVGGL--DEKVSEPL---LWELFLQAGPVVNTHMPK----DRVTGQHQGYGFVEFLSEEDADYAIKIMDMIKLYGKPIRVNKASAHN.............. 96
63 -20.7001x4a_A mol:protein length:109 splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor) variant  ali model follow..  18  36.................................TKDIEDVFYKYGAIRDIDLKN-------RRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEF................... 95
64 -20.6001x5p_A mol:protein length:97 Negative elongation factor E  ali model follow..  19  1GSSGSSGERRAPRKGNTLYVYGE-------DMTPTLLRGAFSPFGNIIDLSMDPPR----------NCAFVTYEKMESADQAVAELNGTQVESVQLKVNI................... 83
65 -20.6002x1a_A mol:protein length:97 MRNA 3`-END-PROCESSING PROTEIN RNA15  ali model follow..  20  2.............PSRVVYLGSI--PYDQTEE---QILDLCSNVGPVINLKMMFDPQTG----RSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSD.............. 84
66 -20.5001x4d_A mol:protein length:102 Matrin 3  ali model follow..  19  1GSSGSSGQKGRVETRRVVHIMDF----QRGKNLRYQLLQLVEPFGVISNHLILNKI----------NEAFIEMATTEDAQAAVDYYTPALVFGKPVRVHLSQKYKRIKSGPSS...... 101
67 -20.5004a8x_A mol:protein length:88 RNA-BINDING PROTEIN WITH SERINE-RICH DOMAIN 1  ali model follow..  18  18.................................KDHIMEIFSTYGKIKMIDMPVERMHPHLSK---GYAYVEFENPDEAEKALKHMDGGQIDGQEITATA................... 81
68 -20.5002d9p_A mol:protein length:103 Polyadenylate-binding protein 3  ali model follow..  26  1GSSGSSGDRITRYQVVNLYVKNL--DDGIDDE---RLRKAFSPFGTITSAKVMMEGGRSK------GFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQSGPSS...... 102
69 -20.5002mxy_A mol:protein length:105 Heterogeneous nuclear ribonucleoproteins C1/C2  ali model follow..  12  1.ASNVTNKTDPRSMNSRVFIGNL----NTLVVKKSDVEAIFSKYGKIVGCSVHK------------GFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAA. 101
70 -20.4002ad9_A mol:protein length:119 Polypyrimidine tract-binding protein 1  ali model follow..  16  13..SHMGDSRSAGVPSRVIHIRKL--PIDVTEG---EVISLGLPFGKVTNLLMLKGK----------NQAFIEMNTEEAANTMVNYYTSVVLRGQPIYIQFSNHKELKT........... 105
71 -20.3005o2v_A mol:protein length:92 Nucleolysin TIA-1 isoform p40  ali model follow..  18  1.........MEDEMPKTLYVGNL--SRDVTEA---LILQLFSQIGPCKNCKMIMDTAGND------PYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTS....... 92
72 -20.3002n3o_A mol:protein length:123 Polypyrimidine tract-binding protein 1  ali model follow..  14  15...........GVPSRVIHIRKL--PIDVTEG---EVISLGLPFGKVTNLLMLKGK----------NQAFIEMNTEEAANTMVNYYTSVVLRGQPIYIQFSNHKELKTDSSPNQARAQA 109
73 -20.3002mzq_A mol:protein length:101 Single-strand telomeric DNA-binding protein GBP2  ali model follow..  13  8AAKFTEGVNPGGDRNCFIYCSNL-------STARSDLFDLFGPIGKINNAELKPQENG-----QPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYARRD............... 101
74 -20.2002lea_A mol:protein length:135 Serine/arginine-rich splicing factor 2  ali model follow..  19  27GSMSYGRPPPDVEGMTSLKVDNLTYRTS-----PDTLRRVFEKYGRVGDVYIPR----DRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGR.............. 122
75 -20.2002jvo_A mol:protein length:108 Nucleolar protein 3  ali model follow..  28  12.GSHMHHRQEGELSNTRLFVRPF--PLDVQES---ELNEIFGPFGPMKEVKILN------------GFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVY................... 93

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.