current user: public

If you have questions about the server, please let us know.

Query: 2e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MFKRETKDFINIDPLQTGGKLTEEARQALLEWGDGYSVCDFCTTGRLDEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKKAKGGRFFLYRELKSRKIHGIKPGLTRYFKLSTYGLSDEEVDYVLNAFKEIIEKYSLast
1 -102.0002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model  100  1MFKRETKDFINIDPLQTGGKLTEEARQALLEWGDGYSVCDFCTTGRLDEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKKAKGGRFFLYRELKSRKIHGIKPGLTRYFKLSTYGLSDEEVDYVLNAFKEIIEKYS 371
2 -70.3005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  52  41LTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCH-GRLDEVTCPPI-KDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGEEEYPTYKINLEGYKEVIDNLEDKGKVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEVKADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFPVKEIEMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKEIKMSVYGLEWEQVEYVVNAIKEIVESC. 410
3 -59.5001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  13  117..YVSRYLIQFDCPGHQGGQYYRKGREFYDFFGETVFRADLCNADVLGDLLIHEPAVAAEKHAARVYNADKTFVLGGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNALAMAGGRPVYLQTNRNPYGFIGGELAAKVDPERAKWKRPFRLAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEIDDLGPEDPGIIVVQSVHKQQAGFSQTSQIHKKDSHIK---QLRYCDHKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGWHDLLITTIEARKKLIKAGSMFRPFVPGDNQYYVDPNKFMLTTPGINPETATIVANYLRDHGIIPEKSDLNSILFLMTPAETPAKMNNLITQLLQLQRLIE 567
4 -59.1002x3l_A mol:protein length:446 ORN/LYS/ARG DECARBOXYLASE FAMILY PROTEIN  ali model follow..  13  13..LNQEEAISLHVPGHKNMT--------IGHLSQLSMTMDKTEIPGLDDLHHPEVILKSMKQVEKHSDYDGYFLVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQEGHFIETHQSPLTNH-----YNKVNLSRLNNDGHKLVVLTYPNYYGETFNVEEVIKSLHQLNIPVLIDEAHGAHFFPDSTLNYQADYVVQSFHKTLPALTMGSVLYIHKNAPY---------RENIIEYLSYFQTSSPSYLIMASLESAAQFYKTYDSTRAQLIECLENKGFE-------------MLQVDDPLKLLIKYEGFTG-HDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYLFDSLLRKIEDMILP 355
5 -56.8002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  15  149..YSDIHEYSWAAPGHQGGVGFTKTRFYHDYYGENLFRTDMGERTSLGSLLDHTAFGESEKYAARVFGADRSSVVVGTSGSNRTIMQACMTDNDVVVVDRNCHKSIEQGLMLTGAKPVYMVPSRNRYGEMQPETLQKKISESPKAGQKPSYCVVTNCTYDGVCYNAKEAQDLLEKTSDRLHFDEAWYGYAYADHYAMRGTVFATHSTHKLLNALSQASYIHVREG-------RGAINFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSEVIDEAVDFRQAMARLYKEFTADGSPDNWSMLDPIKVSILAPGMGEDGAALVTAWLGRHGIVPTRTTDFQIMFLFSMGVTRGKWGTLVNTLCSFKRHYD 606
6 -55.7005xx1_A mol:protein length:756 Arginine decarboxylase  ali model follow..  14  150..YSDIHEYSWAAPGHQGGVGFTKTPSGRF-YGENLFRSDMGERTTLGSLLDHTAFGESEKNAARVFGADRSSVVVGTSGSNRTIMQACMTDNDVVVLDRNCHKSIEQGLILTGAKPVYMVPSRNRYGIIQPETLQKKISASTKAGQKPSYSVVTNCTYDGVCYNAKEAQDLLAKTSDRIHFDEAWYGYA-EPGDHNGPTVFATHSTHKLLNALSQASYIHVREG-------RGAVNFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSEVIDEAVDFRQAMARLYKEFTDEGDPDNWSMLDPIKVSILAPGMGDDGAALVTAWLGRHGIVPTRTTDFQIMFLFSMGVTRGKWGTLINTLCSFKHHYD 607
7 -55.4003n75_A mol:protein length:715 Lysine decarboxylase, inducible  ali model follow..  17  139..YVREGKYTFCTPGHMGGTAFQKSPVGYDFFGPNTMKSDISSVSELGSLLDHSPHKEAEQYIARVFNADRSMVTNGTSTANKIVGMYSAPAGSTILIDRNCHKSLTHLMMMSDVTPIYFRPTRNAYGILQHATIAKRVKETPNATWPVHAVITN-STYDGLLYNTDFIKKTLDVKS--IHFDSAWVPYTMSGGRVEGKVIYETQSTHKLLAAFSQASMIHVKGDVNE----------ETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKIERAIKFRKEIKRLRTESD-KNIDNEHMYLDPIKVTLLTPGMEKDGASIVAKYLDEHGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAFD 561
8 -54.0005fkz_E mol:protein length:710 LYSINE DECARBOXYLASE, CONSTITUTIVE  ali model follow..  14  139..YVKERKYTFCTPGHMGGTAYQKSPVGYDFFGGNTLKADVSSVTELGSLLDHTPHLEAEEYIARTFGAEQSIVTNGTSTSNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFTRDSIEEAQWPVHAVITNSTYDGLLYNTDWIKQTLDVPS--IHFDSAWVPYTMSGERVAGKVIFETQSTHKMLAALSQASLIHIKGEY-----------EEAFNEAFMMHTTTSPSYPIVASVETAAAMLRGNPGKVERALHFRKEVQRLREESD-NDADADHMFLDPVKVTILTPGMDEQGAALVAKFLDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYD 561
9 -51.7005b7s_A mol:protein length:419 Cysteine desulfurase  ali model follow..  17  29......NEVIYFDNTATS-LTPKPVVEAMDEYYLKYRANVHRGVHRLSQ-MATHKYEESRKIVADFIGAEEIVFTKNTSESLNLVALGLFKRGDKIVTTPYEHHSDLLPWQRLGLKLEFIEG--DDEGNLDLSDAEKKIKG------AKLVAVQHVSNALGVIHEVEELGKIAKDEGAIFVVDAAQSAGHMEVNVKKLHADFLAFSGHKGPMGPTGIGVLYIRGGTIEDVSLDGYKLTEPPERFEAGTPNIGGAIGLAAGIRYIERIGLGERQEHKLVKRTTEGLDELEVPWYG-PRNLKKHAGVVSFNVPGLHPHDVAAILDDHSIMVRSGHHCALPGINGTVRASHVYNSLEEVETFLGVMEELVKGLK 412
10 -49.5006c9e_A mol:protein length:422 Cysteine desulfurase  ali model follow..  17  30....NEYDLVYFDNAATT-QKPKAVIDAIAQFYEKDNSNVHRGVHALSV-RATEMYEAARAKVKRFINARECIFVRGTTEAINLVAQSLILPDEEILITHMEHHSNIVPWQMMGCKLQVAPI--SLNGEVILEEFERKLNE-----NTKMVAINYASNSLGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQDLDCDFYAFSGHKMYGP-TGIGVLWGKGEMINSVSFEATEYAAIPHKFEAGTPNIAGAIGLAAAIDYIWSLDLDAEYETQLLNYATKAIEAVKGYNIIGTAANK--VPIISFVHGKIHAHDIGTILDSEGIAIRSGHHCTMPDVAATSRISSFYNTFKEIDYCMEALQRVKEVFA 416
11 -49.4004w91_A mol:protein length:422 Aminotransferase  ali model follow..  17  30....HGKTLVYLDNGASA-QKPQSVIDAVTHAYANEYANVHRGLHFLSN-AATDAYEKSRETVRRFLNADEIVFTKNATEAINTVAYGYIGEGDEILLSIMEHHSNIVPWHFQGAKLVFTPV--DDNGVFHIEEFEKRLSE-----RTKLVAITHMSNTLGTVVPIKKIVELAHARGIPVLVDGSQGAVHLPVDVQDLGCDWYVFTGHKVYGP-SGIGVLYGRGEMIEEVTEENVTYNHPPHRFEAGTPPIVQAIGLGAALEYMEKIGRHLAHEADLRDYAHERLGRINSLRIFGNAPDK--GAIISFALEGIHAHDVSMVIDRAGVAVRAGTHCAQPGVTSTCRASALYNTRAEVDALAEALEKARKFFG 416
12 -49.3001c0n_A mol:protein length:406 PROTEIN (CSDB PROTEIN)  ali model follow..  16  20....NGLPLAYLDSAASA-QKPSQVIDAEAEFYRHGYAAVHAGAHTLSA-QATEKMENVRKRASLFINAEELVFVRGTTEGINLVANSWVRAGDNIIISQMEHHANIVPWQMVGAELRVIPL--NPDGTLQLETLPTLFDA-----ATRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGP-TGIGILYVKEALLQEMLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNAEYEQNLMHYALSQLESVPDLTLYGPQARLGVI---AFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPNVPAMCRASAMYNTHEEVDRLVTGLQRIHRLLG 406
13 -49.2001jf9_A mol:protein length:408 SELENOCYSTEINE LYASE  ali model follow..  16  22....NGLPLAYLDSAASA-QKPSQVIDAEAEFYRHGYAAVHRGIHTLSA-QATEKMENVRKRASLFINAEELVFVRGTTEGINLVANSWVRAGDNIIISQMEHHANIVPWQMVGAELRVIPL--NPDGTLQLETLPTLFDE-----KTRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGP-TGIGILYVKEALLQEMLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVI---AFNLGKHHAYDVGSFLDNYGIAVRTGHHCAMPNVPAMCRASAMYNTHEEVDRLVTGLQRIHRLLG 408
14 -48.5001t3i_A mol:protein length:420 Probable cysteine desulfurase  ali model follow..  17  25....NGHPLVYLDNAATS-QKPRAVLEKLMHYYENDNANVHRGAHQLSV-RATDAYEAVRNKVAKFINAREIVYTRNATEAINLVAYSWLKAGDEIITTVMEHHSNLVPWQMTGAVLKFVQL--DEQESFDLEHFKTLLSE-----KTKLVTVVHISNTLGCVNPAEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHKMCAP-TGIGFLYGKGEMIAEVFFDHFTTGELPHKFEAGTPAIAEAIALGAAVDYLTDLGMEHNYEVELTHYLWQGLGQIQLRLYGPNPKHGDRAALASFNVAGLHASDVATMVDQDGIAIRSGHHCTQPDASGSARASYFYNTKEEIDLFLQSLQATIRFFS 414
15 -48.3005xt5_A mol:protein length:419 Cysteine desulfurase SufS  ali model follow..  16  21....NGHDLVYLDSAATS-QKPRAVIETLDKYYNQYNSNVHRGVHTLGT-RATDGYEGAREKVRKFINAAEIIFTKGTTTSLNMVALSYLKPGDEVVITYMEHHANIIPWQQTGATLKYIPL--QEDGTISLEDVRETVTS-----NTKIVAVSHVSNVLGTVNPIKEMAKIAHDNGAVIVVDGAQSTPHMKIDVQDLDCDFFALSSHKMCGP-TGVGVLYGKGEMIDFVGLYESTWKELPWKFEAGTPIIAGAIGLGAAIDFLEEIGLDSRHEHKLAAYALERFRQLDGVTVYGPEERAGLV---TFNLDDVHPHDVATVLDAEGIAVRAGHHCAQPDVTATARASYLYNTEEEIDKLVEALQKTKEYFT 406
16 -48.2005vpr_A mol:protein length:414 Cysteine desulfurase  ali model follow..  14  21....NGKDLVYLDNAATS-QKPKMVLDAINNYYEHYNANVHRGIHTLSQ-VATEMMEDARKKVQRFINAYEVLFTKGTTEGINLVAYAMIKKDDEIIISYLEHHSNIVPWQMTGAKLRVIPM--NEDGTLQIDVLDEWLSE-----KTKLVSVNQVSNALGIVNPIDEIIRKVRAKSAFIFIDGAQAAPHFEIDVQTMDCDFFAFSGHKMYGP-TGTGILYGKGEMIDHCTFEKTTYAGLPFRFEAGTPNIAGNIAIGTAVDFMEKVGRSAAHEHALLEYAQRKLLEIEGLKVYGEKANR--AGVVSFNLSGIGISDVGMILDKLGIAVRTGHHCTQPGVAGTVRASAVYNTFEEIDILTEGVKKAQKMLA 408
17 -47.7001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  12  15......ANKTYFNFGGQ-GILPTVALEAITAMYGYLQENGPFSIAANQHI--QQLIAQLRQALAETFNVNTITITDNVTTGCDIVLWGLWHQGDEILLTDCEHPGIIAIVARFGITYRFFPVAATLNQGDAAAVLANHLGP-----KTRLVILSHLLWNTGQVLPLAEIMAVCRRHQVRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEIKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQ-ERYQAICQRSEFLWRGLNQLPHVHCLATSAPQA--------LVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDCIRACHYITDEEEINHLLARLADFG.... 389
18 -47.7004lw2_A mol:protein length:404 Cysteine sulfinate desulfinase  ali model follow..  14  20.....QDAGVYLDSAATA-LKPEAVVEATQQFYSLSAGNVHRSQFAEAQ-RLTARYEAAREKVAQLLNAKTIVWTRGTTESINMVAQCYLQPGDEIIVSVAEHHANLVPWLMTGAKVVKLPL--NAQRLPDVDLLPELITP-----RSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGP-TGIGVLYGKGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINESWSRSLATLAEDALAKRPGFRSFRCQD----SSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPGVTGTLRASAPYNTKSDVDALVNAVDRALELL. 402
19 -47.6004q75_A mol:protein length:429 Cysteine desulfurase 2, chloroplastic  ali model follow..  15  35....NGSKLVYLDSAATS-QKPAAVLDALQNYYEFYNSNVHRGIHYLSA-KATDEFELARKKVARFINAREIVFTRNATEAINLVAYSWLKPGDEVILTVAEHHSCIVPWQITGAVLKFVTL--NEDEVPDINKLRELISP-----KTKLVAVHHVSNVLASSLPIEEIVVWAHDVGAKVLVDACQSVPHMVVDVQKLNADFLVASSHKMCGP-TGIGFLYGKGEMISDVFLDHSTYAEPPSRFEAGTPAIGEAIALGAAVDYLSGIGMPHEYEVEIGKYLYEKLSSLPDVRI-RPSESVHRGALCSFNVEGLHPTDLATFLDQQGVAIRSGHHCAQPGVNASARASYFYNTKDDVDAFIVALADTVSFFN 426
20 -46.4005i90_A mol:protein length:427 PvdN  ali model follow..  13  51......PQYLHFANFLL-TSHPRPVREAIERLRVRFDRNPGEAVDWHRE-EIWKYEDEARAWAGRYFAVGQVALTGSTTDGLAAIYGGLVQPGKEILTSSHEHYSTYTTLKRMGTQVREFPLFKDPH-RVSADEILSSIAAQI-RPQTRVLGMTWVQSGSGVKLPIREIGKLVRELNIIYVVDGVHGFGVEDVSFADFDCDYFIAGTHKWLFGPRGTGVIIARSEQLQEHLV-SRADNFGTLMTPGGYHAFEHRLALGTAFELHLQLGKAQARIHQLNAYLKQRLGEHPKVRLVTPTSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVDRDVGP----VVRLASLLNDEAEIDRVLEILAPQLA... 427
21 -45.8005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  14  44.....DPAYRNLNHGSF-GTIPSAIQQKLRSYQTAAEARPCPFLRY----QTPVLLDESRAAVANLLKVETVVFVANATMGVNTVLRNIADGKDEILYFDTIYGACGKTIKRGIVSSRCIPLIYPAEDDDVVAAFRDAIKKSREGKRPRLAVIDVVSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITETDPDFLISNCHKWLFTPRGCAVFYVPVRNQHLIVPAGNKSAFVSNFEFVGTVDNSPFFCVKDAIKWREEV-RIMEYMTKLAREGGQKVAEILGTRVLENSTGTLIREKDVEGLYEIPHEEANMAFKWMYNVLQDEFNTFVPMTFHWARLSAVYLEMSDFEWAGKTLKELCERVA 472
22 -45.6003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  45....SNNFLGNCGVGEREGRVASALVARRH---SGDISAVQPKAAGSSLLNKITSLVLNVIKLAGVHSVASCFVVMATGMSLTLCFLTLRHKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDLRTDLKAVEAKIQEL--GPEHILCLHSTTACFAPRVPDLEELAVICANYDIPHVVNNAYGLQSIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNE----------PFIQDISKMYPGRASASPSLDVLITLLSLRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNGHHDKAVTQLGSMLFTRQVSGARAVP-TFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIV. 443
23 -45.2003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  98.................................SGDISAVQPKAAGSSLLNKITSLVLDIIKLAGVHTVANCFVVPMATGMCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDLRTDLKAVEAKVQEL--GPDCILCIHSTTSCFAPRVPDLEELAVICANYDIPHIVNNAYGVQHLIQQGARVGIDAFVQSLDKNFMVPVGGAIIAGFND----------SFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKKERKEMFSYLSNQIKKLS-LAMTLKTLDEHRDKAVTQLGSMLFTRQVSGARVVP-TFRGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVR 462
24 -41.5003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  18.....GDGWVHFDAPAGM-LIPDSVATTVSTAFRRSGA-STVGAHPSAR-RSAAVLDAAREAVADLVNAGGVVLGADRAVLLSLLAEASAGLGYEVIVSRLDDEANIAPWLRYGAKVKWAEVDI-ETGELPTWQWESLISK-----STRLVAVNSASGTLGGVTDLRAMTKLVHDVGALVVVDHSAAAPYRLLDIRETDADVVTVNAHAWGGP-PIGAMVFRDPSVMNSF-VSTNPYATGPARLEIGVHQFGLLAGVVASIEYLAALDESDAYLNRVFDYLMVSLRSLPLVMLIGRPEAQ--IPVVSFAVHKVPADRVVQRLADNGILAANTGSRVLDDVGGAVTVGAHYSTMAEVDQLVRALASL..... 399
25 -39.3002hzp_A mol:protein length:501 Kynureninase  ali model follow..  13  96......ENAIYFL-GNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKR----TGDESIVGLMKDIVGAKEIALMNALTVNLHLLMLSFTPKRYKILLEAKAFPSDHYAIELHGLNIEESMRMEETLRIEDILEVIEKEGD-----SIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLAGAGGIAGAFIHEKHAHTIMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFKQATMKRKKSVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERLTITFSVPNKDVFQELEKRGVVCDKRNPNGIVAPVPLYNSFHDVYKFTNLLTSILDS.. 490
26 -37.4001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  13  27......EGVIYLD-GNSLGARPVAALARAQAVIAEEWGNGLIRSWNSAG----DLSERLGNRLATLIGAGEVVVTDTTSINLFKVLSAALPERRVIVTETSNFPTDLYIAE---GLADMLQQGYTLRLVDSPEELPQAIDQ-----DTAVVMLTHVNYKTGYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQAGADYAIGCTYKYLGGPGSQAFVWVSPQLCDLVMEPRYEPSNGIARYLCGTQPITSLAMVECGLDVFAQTDMARRKSLALTDLFIELVEQLTLVTPREHAKRGSHVSFEHPEGYAVIQA-----------LIDRGVIGDYREPRIMFGFTPLYTTFTEVWDAVQILGEILDRKT 403
27 -33.1004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  14  2.......AMIYLDHNATT-FIDPRVKEFIISLMDKELNPSSAHSSG----FAKNLIETVRAQIATALGIYDITFTSSGTEGNNLIMKNFYDG--DIFISAIEHLSIYNHIN-YAPNIKVISV--NTQGLVDLEHLEELLAQ--SNTSKKLVSIIMANNESGVLQDIAEIGKITKKYEAKFHSDLVQGFGRIPINIKALGLDFATISGHK-IGGGQGGAALISSSNFQITPMIIGG---GQEKSVRSGTENVLAIAGFGLASALRTDNISENYIKIKKLQNLEKKLKKYPNVNIVSNNVAR-LPNTTLITIPNTDAQAKLIGFDLHNICVSSGSACSSGKISKSHVLTNMGNTVRDIEAFIEAFEEIYDVI. 372
28 -33.1004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  12  2....RGSGSAYLDHAATT-PMHPAAIEAMAAVQRTIGNASSLHTSG----SARRRIEEARELIADKLGAREVIFTAGGTESDNLAVKGIYPHRRRIVTTEVEHHAVLDSVEHEGAHVTWLPT--AADGSVSATALREALQS---HDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLPLDFGASGLSAMSVAGHK-FGGPPGVGALLLRRDVTCVPLMHGG---GQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVELAEIDDVCLNGADDPMRLAGNAHFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPSHVLIAMGSVEADVDAALEVLPGAVARA. 386
29 -32.9005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  16  5.........IYLDNNATT-RIDPKVKEIMDPFLRDHYGNPSS------GTETHPAIAEALDKLYKGINADDVIITSCATESNNWVLKGVYKGKNHIVTTVAEHPAVRSTLESLGVEVTYLPI--NEHGSITAEQVREAITE-----KTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGP-KGIGGLYIRSGVGLTPLFHGG---EHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRKLEEALLKIPDVMVVGDRIHR-VPNTTLVSVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANPVMVAIGNTEAEIDKTIEVFSQAAVRL. 380
30 -32.8005usr_A mol:protein length:426 Cysteine desulfurase, mitochondrial  ali model follow..  15  17....EMLRPLYMDVQATT-PLDPRVLDAMLPYLINYYGNPHSRTHAYGW-ESEAAMERARQQVASLIGAREIIFTSGATESNNIAIKGVASRKKHLITTQTEHKCVLDSLEAEGFQVTYLPV--QKSGIIDLKELEAAIQP-----DTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKIPLDVNDMKIDLMSISGHKIYGP-KGVGAIYIRRR-PRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSRLIQNIMKSLPDVVMNGDPKHHYPGCINLSFAYVEGESL--LMALKDVALSSGSACTSASLEPSYVLRAIGTTEEEVDYTVEKCIQHVKRL. 396
31 -32.7003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  16  20..HNSPERKVYMDYNATT-PLEPEVIQAMTKAMWEAWGNP-SSPYSAGR-KAKDIINAARESLAKMIGGQDIIFTSGGTESNNLVIHSVVKAKPHFITSSVEHDSIRLPLEEQVAAVTFVPVS-KVSGQTEVDDILAAVRP-----TTRLVTIMLANNETGIVMPVPEISQRIKALPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGP--RIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRRLEAEFGQKRIHLNSQFPGTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGSPVLLSYGVSTTRAEVDLVVQDLKQAVAQL. 436
32 -32.4003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  14  15......KLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGAREIVFTSGATESDNLAIKGAAKKGKHIITSKTEHKAVLDTLEREGFEVTYLAP--QRNGIIDLKELEAAMRD-----DTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGP-KGIGALYVRRK-PRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRRLWNGIKDIEEVYLNGDLEHESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELA--HSSIRFSGRFTTEEEIDYTIELVRKSIGRL. 393
33 -32.3001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  16  3.........VYFDNNATT-RVDDRVLEEMIVFYREKYGNPNS------GIEANLHMEKAREKVAKVLGVSEIFFTSCATESINWILKTVAKRKRTIITTPIEHKAVLETLSMKGFKVKYVPV--DSRGVVKLEELEKLVDE-----DTFLVSIMAANNEVGTIQPVEDVTRIVKKKNKETLVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGP-KGVGITYIRKGVPIRPLIHGG---GQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRKLVSGLMNLGAHIITPLEIS--LPNTLSVSFPNIRGSTLQNLLSGYGIYVSTSSACTSKDERLRHVLDAMGNTEEEVDYFLKKIEEILSFL. 376
34 -32.2004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  15  1........MAYFDYTSAK-PVDERILEAMLPYMTESFGNPSS------GFKAREAVQEAREKVAKLVNGGTVVFTSGATEANNLAIIGYARKGKHILVSAVEHMSVINPLQKQGFEVEYIPV--GKYGEVDVSFIDQKLRD-----DTILVSVQHANNEIGTIQPVEEISEVLAGKAA-LHIDATASVGQIEVDVEKIGADMLTISSNDIYGP-KGVGALWIRKEAKLQPVILGG---GQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRRIIDNVLKIEESYLNGHPEKR-LPNNVNVRFSYIEGESIVLSLDMAGIQASTGSACSSKTLQPSHVLMACGNTDEDVDRLLEVLPGVIERL. 373
35 -31.6003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  15  12.VESPPNRKVYMDYNATT-PLEPEVIQAVTEAMKEAWGNPSSS-----GRKAKDIINTARASLAKMIGGQDIIFTSGGTESNNLVIHSTVRTRPHFITCTVEHDSIRLPLEDQVAEVTFVPVS-KVNGQVEVEDILAAVRP-----TTCLVTIMLANNETGVIMPISEISRRIKALNVLVHTDAAQALGKRRVDVEDLGVDFLTIVGHKFYGP--RIGALYVRGVGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRYLEERLEAERIHLNSRFPGVERLPNTCNFSIQGSQLRGYMVLAQCQTLLASVGASCHSDHESPVLLSCGISTTRAEVDLIVQDLKQAVNQL. 428
36 -30.3003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  15  8.LVPRGSHMTYLDAAATT-RVDQRVADIVLHWMTAEFGNAGS------GIRAKRGVERAREYLASTVSADELIFTSGATESNNIALLGLATGRRHIITSAIEHKAVLEPLAGRGFEVDFLTP--GPSGRISVEGVMERLRP-----DTLLVSLMHVNNETGVIQPVAELAQQLRATPTYLHVDAAQGYGKVPGDL-TTPIDMISISGHKIGAP-KGVGALVTRRREEMVPLEPIMFGGGQERKLRPGTLPVPLIMGLAEAAKIFEAEHAQWQVAAQDLRRLLAGLASTSFQVNGDQDHVVPLVTLKDLVAVATGSASTSASFTPSHVLRAMGLPEEAASKSLRFSWTPGQATDLDVEELARGVAKLKPSY. 394
37 -30.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  12  45VLMFGSNSYLGL---TTDTRIIKAAQDALEKYGTGCAGSRFLN--------TLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHN-------NMEDLRAKLSRLPEDSA-KLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTDVDLIMGTFSKSLASLG--GFVAGDADVIDFLKHNARSV------MFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLGATESP-----------ILPIFIRSNEKTFWVTKMLQDDGVFVAVPAEESLIRFSMATHTYDQIDEAIEKMVKVFKQAE 393
38 -29.9002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  16  46TILLGTYNYMGM---TFDPDVIAAGKQALDEFGSGTTGSRVLN--------TYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHN-------SVEDLDKRLGRLPAEAG-KLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVDVDFVVGTFSKSVGTVG--GFCVSNHPKFEVLRLVCRPY------VFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSA---------IIAVILTDMAQAVALWQGLLEAGLYVATPAGMFLLRCSCAEHSDEQVEQILGMFESAGRATG 396
39 -29.6002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  13  41DIILQSNDYLAL---ANHPLIKARLAKSLLEEQQSLFMSASF-------LQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDH-----------LRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLEVHFMTASLAKTFAYRA--GAIWCNNEVNRCVPFISYPA------IFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQ------------IIGLETGDERNTEKVRDYLESNGVFGATSKNKNIIRLSNSDVNDEQIAKIIEVCSDAVNYGD 385
40 -29.5002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  16  59.AVIRGKDTILLGTYNYMGDVIAAGKEALEKFGSGTNGSRMLN--------TFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHN-------SVEDLDKRLGRLPKEPA-KLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVQIDFVVGTFSKSVGTVG--GFVVSNHPKFEAVRLACRPY------IFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSA---------IVAVMLEDQEQAAMMWQALLDGGLYVATPAGTFLLRCSCAEHTPAQIQTVLGMFQAAGRAVG 416
41 -29.5001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  16  47VINFCANNYLGL---ANHPDLIAAAKAGMDSHGFGMASVRFIC--------TQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANN-------DMQELEARLKEAREAGRHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSRVDIITGTLGKALGGASG-GYTAARKEVVEWLRQRSRPY------LFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHA-----------IIPVMLGDAVVAQKFARELQKEGIYVVVPKGQARIRTQSAAHTPEQITRAVEAFTRIGKQLG 398
42 -29.1004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  15  75.AVIRGKDTILLGTYNYMGDVIAAGKEALEKFGSGTNGSRMLN--------TFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHN-------SVEDLDKRLGRLPKEPA-KLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVQIDFVVGTFSASVGTVG--GFVVSNHPKFEAVRLACRPY------IFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSA---------IVAVMLEDQEQAAMMWQALLDGGLYVATPAGTFLLRCSCAEHTPAQIQTVLGMFQAAGRAVG 432
43 -29.1003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  13  55DIILQSNDYLAL---ANHPLIKARLAKSLLEEQQSLFMSASF-------LQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDH-----------LRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLEVHFMTASLAKTFAYRA--GAIWCNNEVNRCVPFISYPA------IFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQ------------IIGLETGDERNTEKVRDYLESNGVFGATSKNKNIIRLSNSDVNDEQIAKIIEVCSDAVNYGD 399
44 -28.8003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  16  45VLNFCANNYLGL---ADHPALIKTAQTVVEQYGFGMASVRFIC--------TQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNN-------AMGDLEAKLKEADEKGRFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTRVDILTGTLGKALGGASG-GYTSGHKEIIEWLRNRSRPY------LFSNTVAPVIVATSLKVLELLKTEGPQLRKQLENSRYFRAGMEKLGFQLVPGNHP-----------IIPVMLGDAQLATNMADHLLQEGIYVVVPMGKARIRVQSAVHTQQQLDRAIEAFGQVGKKLG 397
45 -28.2001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  13  37.....................................................GVVEQIRQQLTALATASEVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVARPDVQAIDAILNA---DPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLMEDNHGKWRFTSPTHTVLAFAQALKELAKE-ARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPII-----TAFYSPEDPQYRFSEFYRRLKEQGFVIYKVSQSDCFRIGNIGEYAADITALLTAIRTAMYWTK 366
46 -28.1001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  14  41YLNFSSNDYLGL---SHHPQIIRAWQQGAEQFGIGSGGSGHVS--------YSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHN-------DVTHLARLLASPCPGQ--QMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRKVKPELLVVTFGKGFGVSG--AAVLCSSTVADYLLQFARHL------IYSTSMPPAQAQALRASLAVIRSD-ARREKLAALITRFRAGVQDLPFTLADSCSA-----------IQPLIVGDNSRALQLAEKLRQQGCWVTVPAGTARLRLTTAAHEMQDIDRLLEVLHGN..... 383
47 -28.1002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  16  127.....................................................ALTNKILESFFKQLGLNVTPISTGMSISLCLSAARKKYGSNVVIYPYASHKSPIKAVSFVGMNMRLVETLDGDRVYVPVEDIENAIKKEIELGNRPCVLSTLTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNYYLEKKYRVDAVVSSSDKNLLTPIGGGLVYSTDA----------EFIKEISLSYPGRASATPVVNTLVSLKNYLELVKNQKNSKKLLDELLNDLSKKTGGKFLDVESPIASCISVNSDPVELYNLRVTGPRGIKKTDHFGNCYLGTYTHDYIVMNAAIGVRTEDIVNSVSKLEKI..... 448
48 -27.7003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  13  46.....................................................STMLENEKFMLEYAKAPEVFMTCSSTGSMEAVVMNCFTKKDKVLVIDGGSFGHRFVQLCEIHEIPYVALKLEHGKKLTKEKLYEYDNQNFT-----GLLVNVDETSTAVLYDTMMIGEFCKKNNMFFVCDCVSAFLADPFNMNECGADVMITGSQKVLACPPGISVIVLAPRGVERVEKSKVDLKDALKNQERGQTPFTPAVGILLQINERLKEIKKHGRIASQAADFRAKIKDLPFELVSESP---------ANGVTSVHPTTANAYDIFLKLKDEYGIWIC-EMKDTIFRVGHIGATHEDNTTLVNAFKDLQKRNL 369
49 -27.5003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  13  53ELDLASNDYLGL---SQHPDVLDGGVEALRTWGGGAGGSRLVT--------NTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHR-------DVDAVDAALAARTEER--AVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVMTTTLSKALGSQG--GAVLGPEAVRAHLIDTARSF----------IFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELATIAGVTEAPVSA-----------VVSVILGDPEIAVGAAAACLDRGVRVTVPAGTSRLRLARASLTDDEMALARQVLTDVLATAR 397
50 -27.2005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  13  43IIGFASNDYLGL---AAHPQLIAAIAEGAQRYGAGSGGSHLLG--------HSRAHAQLEDDLAEFVGGARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHC-------DTDALSAMLEAS--DADVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAPNLISIGTLDKAAGVSG--AFVAAHETVIEWLVQRARPY------IFTTASVPAAAHAVSASLRIIGGE-ARRAHLQQLIGRTRAMLKATPWLPVDSHTA-----------VQPLIIGANDATLEIAATLDRAGLWVTVPTGTSRLRISSAAHSQADLDRLEAGLQQLGAKAA 396
51 -27.1002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  16  55.....................................................QIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVGERIGARVHPMTKDPGGHYTL------QEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTK-CDDQPRMYHHTIPVISLYSLRESLALIAEQ-NSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVMDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALVAQA 388
52 -27.0003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  16  56.....................................................QIMEEIKQGIQYVFQTRNLVVSGSGHCAMETALFNLLEPGDSFLTGTNGIWGMRAAADRIGARVHQMIKKPGEHYTL------QEVEEGLAQHKPVLLFLVHGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTK-CEGETRVIHHTTPVTSLYCLRESLALIAEQ-NCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVTVPAGYNWRDIVSYVLDHFSIEISGGLGPTEERVLRIGLLGYNATTENVDRVAEALREALQHCP 389
53 -26.9005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  14  41IVGFASNDYLGL---AAHPKLVAAFAEGAQRYGSGSGGSHLLG--------HSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHA-------DTATLGALLEACTSQT--KLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGAPHLVYVGTLGXAAGVAG--AFVVAHETVIEWLIQRARSY------IFTTAAPPAVAHAVSASLKVIAGD-ARRAHLAALIERTRALLRRTRWQPVDSHTA-----------VQPLVIGSNEATLAAMRALDAHGLWVTVPAGTSRLRISSAAHSFDDLARLETALLRASEE.. 392
54 -26.8004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  12  47IIDFTTSDYLNL---SSAHNLKHAIVNGFDKYGFGSKGSNIVC--------YTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQ-------QLSQLQDIYDGK------SFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGANCLICVFPLGKAFGGVG--AVVCTTEAIAEYLIQFARNY------IYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDLSP----------IRSIQLNNANLAIRLKDKLFENKIIVTVPKDQAILRFSHSNNTFDQIQQALEIISKEVKYEY 389
55 -26.8004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  16  57.....................................................QIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVGERIGARVHPMTKDPGGHYTL------QEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVAFLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTK-CDDQPRMYHHTIPVISLYSLRESLALIAEQ-NSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCP 390
56 -26.7005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  16  60.....................................................QIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVGERIGARVHPMTKDPGGHYTL------QEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTK-CDDQPRMYHHTIPVISLYSLRESLALIAEQ-NSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCP 393
57 -26.7004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  16  55.....................................................QIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVGERIGARVHPMTKDPGGHYTL------QEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTK-CDDQPRMYHHTIPVISLYSLRESLALIAEQ-NSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVMDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCP 388
58 -26.7002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  14  51.....................................................RTMDEVKDGLRYIFQTENMCVSGSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAVSERYGADVRTIEGPPDRPFSL------ETLARAIELHQPKCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSKVDEPKRYHHTVASNLIFALREALAQIAEE-NQIKRRIECAQILYEGLGKMGLDIFVKDPRHRLPTVTGIMIPKGVDWWKVSQYAMNNFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIQFYLYGFKESLKATH 384
59 -26.7001vjo_A mol:protein length:393 alanine--glyoxylate aminotransferase  ali model follow..  14  61.....................................................ALMDEIQSLLRYVWQTENIAVSGTGTAAMEATIANAVEPGDVVLIGVAGYFGLVDMAGRYGADVRTISKPWGEVFSL------EELRTALETHRPAILALVHAETSTGARQPLEGVGELCREFGTLLLVDTVTSLGGVPIFLDAWGVDLAYSCSQKGLGCSPGASPFTMSSRAIEKLQRRRTKVANGSERVYHHTAPINLYYALREALRLIAQE-NCWQRHQKNVEYLWERLEDIGLSLHVEKEYRLPTLTTVC-------PDGVDGKAVARRLLNEHNIEVG-ELAGKVWRVGLMGSRKESVDQLIPALEQVLR... 387
60 -26.7005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  13  58VTVWCSNDYLAL---SKHPEVLDAMHKTIDKYGCGAGGTRNIA--------HNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDIFSDELNHASMIVGIKHANVKKHIFKHN-------DLNELEQLLQSYPKSVP-KLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVRVDMITGTLGKSFGSVG--GYVAASRKLIDWFRSFAPGF------IFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNP----------SHIVPVLIGNADLAKQASDILINKHQIYVTVARGTERLRITTPGHTNDLSDILINAVDDVFNELQ 431
61 -26.6002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  11  48ITVWCGNDYLGM---GQHPVVLAAMHEALEAVGAGSGGTRNIS--------TTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHN-------DVAHLRELIAADDPAAP-KLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVRIDIFNGTLAKAYGVFG--GYIAASARMVDAVRSYAPGF------IFSTSLPPAIAAGAQASIAFLKTAEGQKLRDQMHAKVLKMRLKALGMPIIDHG----------SHIVPVVIGDPVHTKAVSDMLLSDYGVYVTVPRGTERLRFTSPVHDLKQIDGLVHAMDLLWARCA 401
62 -26.6002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  14  34...............................................DVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNFPRTSLIAIENTHNRSGGRVENIKEICTIAKEHGINVHIDGANASIASGVPVKEYYADSVMFCLSKGLCAPVG-SVVVGDRDFIERARKARKMLGGGMRQA----------VLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHG--------FIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS 349
63 -26.5002dr1_A mol:protein length:386 386aa long hypothetical serine aminotransferase  ali model follow..  16  53.....................................................KVHMDTVERLREFLEVEKLLVPSSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYKEVVESNGRKAVVLEYEPGKAVKPEDLDDALRK---NPDVEAVTITYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGGADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMPER---KEKESTPSTPPMPQVFGINVALRIIEKM-KWLEMYEKRAKMVREGVREIGLDILAEPGHE-------SPTITAVLTPPGIKGDEVYEAMRKRGFELA-SVKEKTFRIGHMGYKFEDIQEMLDNLREVINELK 380
64 -26.4002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  15  52.....................................................KIMDDIKEGVRYLFQTNNFCLSASGHGGMEATLCNLLEDGDVILIGHTGHWGDRSAATRYGADVRVVKSKVGQSLSL------DEIRDALLIHKPSVLFLTQGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLGGAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKVKVGRPRIYHHTISSTLLYGLREAIAMACEE-ALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIK-------PQGVDWLKAAQYAMKTYLVEIS-PTAGQVFRIGLMGQTTERVDRVLQVFQEAVAAVK 384
65 -26.3002z9u_A mol:protein length:392 Aspartate aminotransferase  ali model follow..  13  42.....................................................LLYEKVVDKAQKAMRLSNVILHGEPVLGLEAAAASLISPDDVVLNLASGVYGKGFGYWAKRYSPHLLEIEVPYNEAIDPQAVADMLKA---HPEITVVSVCHHDTPSGTINPIDAIGALVSAHGAYLIVDAVSSFGGMKTHPEDCKADIYVTGPNKCLGAPPGLTMMGVSERAWAKMKANPLAPRASMLSIVD-TPSVSEINGLDVALDLYLNE-AVWARHALTAKAMRAGVTAMGLSVWAASDSIASPTTTAVRTPDGVDEKALRQAARARYGVVFSSGRGETLGKLTRIGHMGPTAQPIYAIAALTALGGAMNAAG 372
66 -26.1003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  13  67...................................................TKLLEEKAVALLGSLLNNKDAHIVSGGTEANLMALRCIKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPI--KEDYTIDEKFVKDAVED----YDVDGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKLGVDSITIDPHKMGHCPIPSGILFKDIGYKRYLDVDAPYLTETRQATILGTRVGFGGACTYAVLRYLEGQRKIVNECMENTLYLYKKLKENNFKPVIEPI-------------LNIVAIEDEDYKEVCKKLRDRGIYVSVCNCVKALRIVMPHIKREHIDNFIEILNSIKRD.. 397
67 -25.9003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  16  44.....................................................GIMNETMEMLRELFQTKNYPIDGTSRAGIEAVLASVIEPEDDVLIPIYGRFGYLLTAERYGANVHMLECEWGTVFDP------EDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKV-YWSERRLNHHTEATTMLYALREGVRLVLEE-TRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVTCVE-------PGGIDGESVRDMLLAQFGIEIA-PLAGKIWRIGTMGYRKENVLFVLAGLEAVLLRHN 391
68 -25.8003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  12  46.....................................................HYMNEVMALYRGVFRTENMLVDGTSRAGIEAILVSAIRPGDKVLVPVFGRFGHLLCARRCRAEVHTIEVPWGEVFTP------DQVEDAVKRIRPRLLLTVQGDTSTTMLQPLAELGEICRRYDALFYTDATASLGGNPLETDVWGLDAVSAGMQKCLGGPSGTSPITLSARMEEAIRRRKCV-YWGPERLNHHTEATTALFGARECARLILQE-YGIARHKLHGDALVKGIQAMGLETFGDLKHKMNNVLGVV-------PQGINGDQARKLMLEDFGIEIG-PLHGKVWRIGTMGARKDCVMTTLSALEAVLNYLK 391
69 -25.5002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  13  33.....................................................RVNRAIQERLAALFDPGEAALAGSGSLGMEAGLANL--DRGPVLVLVNGAFSQRVAAALHGLDPEVLDFPPGEPVDP------EAVARALKRRRYRMVALVHGETSTGVLNPAEAIGALAKEAGALFFLDAVTTLGMLPFSMRAMGVDYAFTGSQKCLSAPPGLAPIAASLEARKAFTGKRGWYLD-ERGGYHHTTPVLLHYALLEALDLVLEE-ARERRAREVYAWVLEELKARGFRPYPKASPLPTVLVVRPP--EGVDADRLVRALYAEGVAVAGGI----PTRGQVLRLGLMGARREAYQAFLKALDRALAL.. 352
70 -25.4001wyt_A mol:protein length:438 glycine dehydrogenase (decarboxylating) subunit 1  ali model follow..  13  57LAAQNLPAHKAFLGGGVRSHHVPPVVQALAARGEFLTA--YTPYQPEVSQGVLQATFEYQTMIAELAGLENASMYDGATALAEGVLLALETGRMGVLVSQGVHPEYRAVLRAYLEAV---------GAKLLTLPLEGGRTPLPEVGEEVGAVVVQNPNFLGALEDLGPFAEAAHGAGALFVAVADPLSLGVLKPPGAYGADIAVGDGQSLGLPMGHFGFLATKKAFVRQLQAREQYIRRAKAKSNITTNAQLTALMGAMYLAALEGLREVALKSVEMAHKLHALLLEVPGVRPFTP----------KPFFNEFALALPKDPEAVRRALAERGFHGATPVPRLALFAATELHEEEDLLALREALKEVLA... 438
71 -25.0001iug_A mol:protein length:352 putative aspartate aminotransferase  ali model follow..  14  34.....................................................EVFLKARGLLREAFRTEGLILTGSGTLAMEALVKNLFAPGERVLVPVYGKFSEYEIALEAGLVVERLDYPYGDTPRP----------EDVAKEGYAGLLLVHSETSTGALADLPALARAFKEKNGLVGADMVTSLLVGEVALEAMGVDAAASGSQKGLMCPPGLGFVALSPRALERLKPRGRELKAQKEGESAWTPAINLVLAVAAVLEEVLPREEHLALKAWQNALLYGVGEEGGLRPVPKRF---------SPAVAAFYLPEGVPYARVKEAFAQRGAVIA-PLKGKVFRLSLMGADRYEALGVAGMFREVLEEIL 349
72 -25.0003zrp_A mol:protein length:384 SERINE-PYRUVATE AMINOTRANSFERASE (AGXT)  ali model follow..  13  35.....................................................EALAYSLKGLRYVMGASQPLIIPGGGTSAMESVTSLLKPNDKILVVSNGVFGDRWEFKRYPVNVKVLRPSPGDYVKP------GEVEEEVRKSEYKLVALTHVETSTGVREPVKDVINKIRKYVELIVVDGVSSVGAEEVKAEEWNVDVYLTASQKALGSAAGLGLLLLSPKALSILDSQNSIAGEEGKAAYFATPPVHVILQLAEAFRLIEKE-NRIKRHTMVASAIRAGLEALGLEIVARRPESYSNTVTGVILKVADPQK-------VLAGTVNEGVEFAVHPAFKYFRIGHMGWTPNDAIIAISVIERTLRKLG 364
73 -25.0003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  13  112.................GDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVV-----AMTAHMLGGDAATVTSGGTESLLLAMKTYRDTAPEAVVPVSAHAAFDKAAQYFGIKLVRTPL--DADYRADVAAMREAITP-----NTVVVAGSAPGYPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPWAERL-GVTSVSADTHKYGYGAKGTSVILYRRPDLQYFIAADWPGGLYFSPTFAGSRPGALSATAWAAMLSLEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDELNIYQVMEEMAGRGWRLNGLHRPPAFH---------VALTLRHTEPGVVDRFLADLQDAVAQV. 473
74 -24.6004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  13  124...................................................LRKIEAEIVRIACSLFNGGPDCVTSGGTESILMACKAYRDKTPEIVAPQSAHAAFNKAASYFGMKIVRVPL--TKMMEVDVRAMRRAISR-----NTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKA-GVTSISADTHKYGYAPKGSSLVLYSDKKYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFNGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDF----------DIYRLSNLMTAKGWNLNQLQFPPSIHITLLHARKRVAIQFLKDIRESVTQI. 454
75 -24.5004j8l_A mol:protein length:361 Uncharacterized protein YhfS  ali model follow..  10  10.............TIIEAQQKQFALVDSICRHFPGSEFLTGGDLGLTPGLNQPRVTQRVEQVLADAFAQAAALVQGAGTGAIRAGLAALLKPGQRLLVHDAPVYPTTR-IEQMGLTLITVDFND-----------LSALKQVVDEQQPDAALVQHTRQQPQDSYVLADVLATLRAAGVPALTDDNYAVMKVARIGCECGANVSTFSCFKLFGP--GVGAVVGDADVINRI--------RATLYSGGSQIQGAQALEVLRGLVFAPVMHAVQAGVSERLLALLNGAQSKVLIVEFHQPIAARVLEEAQKRGALPYPVGAESKYEIPPLFYRLSGTFRQANPQSEHCAIRINPNRSGEETVLRILRESIASI. 361

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.