current user: public

If you have questions about the server, please let us know.

Query: 2eo5_A mol:protein length:419 419aa long hypothetical aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MLSRKIIEESDIYLATSTRDPELFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWPSHPEVIKIGIEQMQKLAHAAANDFYNIPQLELAKKLVTYSPGNFQKKVFFSNSGTEAIEASIKVVKNTGRKYIIAFLGGFHGRTFGSISLTASKAVQRSIVGPFMPGVIHVPYPNPYRNPWHINGYENPSELVNRVIEFIEDYIFVNLVPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGIMPIGATIFRKDLDFKPGMHSNTFGGNALACAIGSKVIDIVKDLLPHVNEIGKIFAEELQGLADDVRGIGLAWGLEYNEKKVRDRIIGESFKRGLLLLPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVVKLast
1 -108.0002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model  100  1MLSRKIIEESDIYLATSTRDPELFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWPSHPEVIKIGIEQMQKLAHAAANDFYNIPQLELAKKLVTYSPGNFQKKVFFSNSGTEAIEASIKVVKNTGRKYIIAFLGGFHGRTFGSISLTASKAVQRSIVGPFMPGVIHVPYPNPYRNPWHINGYENPSELVNRVIEFIEDYIFVNLVPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGIMPIGATIFRKDLDFKPGMHSNTFGGNALACAIGSKVIDIVKDLLPHVNEIGKIFAEELQGLADDVRGIGLAWGLEYNEKKVRDRIIGESFKRGLLLLPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVVK 419
2 -89.8004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  32  26.KSQALAERRSAVVAAGVAS--GVPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGA-SDPAVVAAVQEAAAHFTHTCFMVTPYEGYVAVTEQLNRLTPGDHAKRTVLFNSGAEAVENAVKVARLTGRDAVVAFDHAYHGRTNLTMALTAKAMPYKTNFGPFAPEVYRMPMSYPFREENP-------EITGAEAAKRAITMI-EKQIGGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGG-LPLSAITGRADLLDAPGGLGGTYGGNPVACAAALAAIDTMHDLNGRARHIEELALGKLRELVGDIRGRGAMLAIELVQPGSTKAVAAACLKEGVIILTCGGNVIRLLPPLVISDELLIDGLEVLAAAIKAHA 456
3 -89.1005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  21  8INWEQVKEWDRKYLMRTFSTQNEYPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQ-KNQKVNAAIKEALDRYGFVW-DTYATDYKAKAAKIIIEDILGDEDGKVRFVSTGSEAVETALNIARLYNRPLVVTREHDYHGWTGGAATVTRLRSYRSGPGSSYNSAVLMAPSPNMFQDSDGNL--LKDENGELLSVKYTRRMI--ENYGPEQVAAVITEVSQGAGSAM-PPYEYIPQIRKMTKELGVLWINDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVLVSKEIAAHRWESVSTYAGHPVAMAAVCANLEVMENFVEQAKDSGEYIRSKLELLIGNFDGYGLLWIVDIVNAKTKTPIMKKALEKGVLIGGVMPNTMRIGASLNVSRGDIDKAMDALDYALDYLE 469
4 -88.7004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  27  33.TEEDFFACDRQYVCQNYAP---VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLTLTL-RAFGNDVTGPACRFMAEMFGYD---RVLLMNTGAEAGESALKIARKWASAKVILCNNNYWGRTITACSSSTTFD-CYNNFGPFTPGFELIDYDD---------------------VGALEEAL-----KDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMLKPGTHGSTFGGNPLACAVAVEALTVLEKLADRAERLGAQFRDCLRREIKEIRGRGLLNAVEVDSDADPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVE 436
5 -88.4004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  34  18.KASKLIDEENKYYARSAR-INYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGH-THEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKLAKIAPGNSPKMVSFGNSGSDANDAIIKFARATGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTRKIGPMLPSVVHVPYPDSYRTYPG----ETEHDVSLRYFNEFKKPF-ESFLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASG-MPLSAVIGKKEVMQSAPAHLFTTAGNPVCSAASLATLDVIEGLVEKSATDGAYAKQRFLEMIGDVRMWGLNGGIELVKDPKTKEVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAVE 447
6 -88.3001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  31  39.TSDDIFEREYKYGAHNYHP---LPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGH-CHPKIVNALKSQVDKLTLTS-RAFYNNVLGEYEEYITKLFNYH---KVLPMNTGVEAGETACKLARKWGKAKIVFAAGNFWGRTLSAISSSTDPT-SYDGFGPFMPGFDIIPYND---------------------LPALERAL-----QDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMIKPGEHGSTYGGNPLGCRVAIAALEVLENLAENADKLGIILRNELMKLVTAVRGKGLLNAIVIKETKDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF. 439
7 -88.2005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  22  8INWEQVKEWDRKYLMRTFSTQNEYPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQ-KNQKVNAAIKEALDRYGFVW-DTYATDYKAKAAKIIIEDILGDEDGKVRFVSTGSEAVETALNIARLYNRPLVVTREHDYHGWTGGAATVTRLRS-FRSGLVGENSAVLMAPSSNTFQDSNGNY--LKDENGELLSVKYTRRMI--ENYGPEQVAAVITEVSQGVGSTM-PPYEYVPQIRKMTKELGVLWISDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVVVSKEIAAHRWESVSTYAGHPVAMAAVCANLEVMENLVEQAKNSGEYIRSKLELLIGNFDGYGLLWIVDIVNAKTKTPIMEKALEKGVLIGGAMPNTMRIGASLNVSRGDIDKAMDALDYALDYLE 469
8 -88.1004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  31  34.LNREVIEYFKEHVNPGFLEGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGH-RNPVVVSAVQNQLAKQPLHS-QELLDPLRAMLAKTLAALTPGKL-KYSFFCNSGTESVEAALKLAKAYGKFTFIATSGAFHGKSLGALSATAKST-FRKPFMPLLPGFRHVPFGN---------------------IEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSNPFLHTTTFGGNPLACAAALATINVLQNLPAQAEQKGDMLLDGFRQLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAMR 453
9 -87.9004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  27  18.TEEDFFACDRQYVCQNYAP---VPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGH-CHPRVIAALCRQAERLTLTL-RAFGNDVTGPACRFMAEMFGYD---RVLLMNTGAEAGESALKIARKWASAKVILCNNNYWGRTITACSSSTTFD-CYNNFGPFTPGFELIDYDD---------------------VGALEEAL-----KDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMLKPGTHGSTFGGNPLACAVAVEALTVLEKLADRAERLGAQFRDCLRREIKEIRGRGLLNAVEVDSDADPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVE 421
10 -87.5001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  31  3.SNKELMQRRSQAIPRGVGQI--HPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGH-LHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAAKRSGTIAFSGAYHGRTHYTLALTGKVN-PYSAGMGLMPGHV---YRALYPCPLHGISEDDAIASI--------HRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGG-FPLAGVTGRAEVMDAPGGLGGTYAGNPIACVAALEVLKVFENLLQKANDLGQKLKDGLLAIIGDVRGLGAMIAIELFEDGDHNKIVARARDKGLILLSCGYNVLRILVPLTIEDAQIRQGLEIISQCFDEAK 425
11 -87.5005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  31  32.LNREVIEYFKEHVNPGFLEGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGH-RNPVVVSAVQNQLAKQPLHS-QELLDPLRAMLAKTLAALTPGKL-KYSFFCNSGTESVEAALKLAKAYGKFTFIATSGAFHGKSLGALSATAKST-FRKPFMPLLPGFRHVPFGN---------------------IEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSNPFLHTTTFGGNPLACAAALATINVLQNLPAQAEQKGDMLLDGFRQLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAMR 451
12 -87.4003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  27  23.RSQALIDRKGTAVARGVGT--TMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGN-SAPKVVEAVRSQVGDFTHTCFMVTPYEGYVAVCEQLNRLTPVRGDKRSALFNSGSEAVENAVKIARSHHKPAVVAFDHAYHGRTNLTMALTAKVMPYKDGFGPFAPEIYRAPLSYPFRDA---EFGKELATDGELAAKRAITVI-DKQIGADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGG-LPLSAVTGRAEIMDSVSGLGGTYGGNPIACAAALATIETIEGLVARAQQIEKIMKDRLGRLIGDVRGRGAMIAMELVKAGTTKALCAGAHAAGVIVLSCGGNVVRFLPPLSIGDDLLNEGLDVLEEVLRGA. 451
13 -87.3001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  32  22.TPEDYINNELKYGAHNYDP---IPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGH-CHPNILNAMINQAKNLTICS-RAFFSVPLGICERYLTNLLGYD---KVLMMNTGAEANETAYKLCRKWGMAKIVVCKNNFSGRTLGCISASTTKK-CTSNFGPFAPQFSKVPYDD---------------------LEALEEEL-----KDPNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGHYPISAVLANDDIMIKPGEHGSTYGGNPLAASICVEALNVLEKLCENAEKLGGPFLENLKREVRDVRGKGLLCAIEFKNELNVLDICLKLKENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTVKFFD 424
14 -87.1003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  30  30.ISQELQARKQSAVAAGVGV--TLPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGN-SAPAVVDAVTQQVAAFTHTCFMVTPYEGYVKVAEHLNRLTPGDHEKRTALFNSGAEAVENAVKIARAYRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKHGFGPFANEVYRVPTSYPFRDGET--------DGAAAAAHALDLIN--KQVGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHENVVPDLIVTAKGIAGG-LPLSAVTGRAEIMDGSGGLGGTYGGNPLACAAALAVIDTIENLVARARAIGETMLSRLGALIGEVRGRGAMIAVELVKPGTTKRVAAAAHAQGLVVLTCGGNVLRFLPPLSMPDHLLDEGLDILAAVFAEVK 453
15 -86.7004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  32  26.RSGALAERRRAAVSAGV--GSTAPVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGA-SHPAVAAAIADQATHFTHTCFMVTPYEQYVQVAELLNALTPGDHDKRTALFNSGAEAVENAIKVARLTGRPAVVAFDNAYHGRTNLTMALTAKSMPYKSQFGPFAPEVYRMPASYPLRDEPGLT----GEEAARRAISRIETQI-----GAQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFARTGAWFASEHEGIVPDIVTMAKGIAGG-MPLSAVTGRAELMDAAGGLGGTYGGNPVTCAAAVAALGVMLDLPARARAIEASVTSRLSALIGEVRGRGAMLAIEIVKPGTTKSIAAEALSQGVLILTCGGNVIRLLPPLVIGDDLLDEGITALSDIIRAKA 450
16 -86.6003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  28  34.ASLELNKRRAAAVSGGVGV--TLPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGN-SAPRVVDAVRDQVEQFTHTCFMVTPYEQYVAVAEQLNRITPGSGEKRTVLFNSGAEAVENSIKVARATRKQAVVAFDYAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPVSYPYRDNLLDKDIATDGELAAERAINL----IDKQIGAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADG-FPLSAVTGRAEIMDATSGLGGTFGGNPVACAAALATIETIDGMVERARQIERLVMDRLLRLLGDVRGRGAMIAMELVKSGTTQKLAAAAHAAGVIVLTCGGNVIRLLPPLTISDELLSEGLDILCQILAD.. 461
17 -86.4005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  34  30.KASKLIDEENKYYARSAR-INYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGH-THEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKLAKIAPGNSPKMVSFGNSGSDANDAIIKFARATGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTRKIGPMLPSVVHVPYPDSYRTYPG----ETEHDVSLRYFNEFKKPF-ESFLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASG-MPLSAVIGKKEVMQSAPAHLFTTAGNPVCSAASLATLDVIEGLVEKSATDGAYAKQRFLEMIGDVRMWGLNGGIELVKDPKTKEVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAVE 459
18 -86.3003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  31  9.SSQDYMNNELTYGAHNYDP---IPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGH-CHPDILNAMINQAKKLTICS-RAFFSDSLGVCERYLTNLFGYD---KVLMMNTGAEASETAYKLCRKWGSAKIIVCNNNFSGRTLGCVSASTDKK-CKNNFGPFVPNFLKVPYDD---------------------LEALEKEL-----QDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGHYPISAILANDDVMLKPGEHGSTYGGNPLAAAICVEALKVLEKLCENADKLGAPFLQNLKEQVREVRGKGLLCAIEFKNDLNVWDICLKFKENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFFD 411
19 -85.9003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  28  7KQTDELLAKDEQYVWHGMRPFSPNTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGY-GRKELAEAAYKQLQTLSYFP-MSQSHEPAIKLAEKLNEWLGG--EYVIFFSNSGSEANETAFKIARQYHRYKFMSRYRGYHGNTMATMAATGQAQ-RRYQYEPFASGFLHVTPPDCYRMPGI----ERENIYDVECVKEVDRVMTW--ELSETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKAFGFMNYDVKPDIITMAKGITSAYLPLSATAVKREIYEAFFRHINTFGGNPAACALALKNLEIIENLIERSAQMGSLLLEQLKEEVGDIRGKGLLVGIELVNDKETKEVVNACKEKGLIIGRNGNNILTLAPPLVISSEEIAFVIGTLKTAMERI. 452
20 -85.8005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  33  8.NSEYFIELEEKHGAHNYHP---LPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGH-SHPKIVEALVEQASKLALTS-RAFYNSKLGEYEQKITSLLGFD---KVLPMNSGAEAVETAVKLARKWSAAKIIVCENNFHGRTTTIVSFSNDPD-ANQNYGPFTPGFIRIPYND---------------------IAALEEVLSKE---AGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKLIACHHEDVQPDILILGKALSGGMYPVSAVLANNNIMIKPGQHGSTFGGNPLACAVAMAALDVVEKLSERAEKLGNLFRSEIEKLITKVRGKGLLNAILINDTSTAWNLCLALKENGLLAKPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF. 413
21 -85.8005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  17.SLEQLLEMDRAHFMHPSTHAYDHGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGY-GREEVADAIYEQAKQLAYYHTVGHSNDPVIELSSRIIEDWAPAGMKKVFYGMSGSDANETQIKLVWYYNKKKIIARERSYHGSGIVTGSLTGLPS-FHQHFDLPIDRVKHTVCPHWYNAPPG----MSEAQFVAYCVEELEKLIAR--EGADTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKTGSEHYGIKPDLITVAKGLTSAYAPLSAVIVSEKVWDVVMGHGWTYSGHPVCAAAALANLDILENLTGNAADVGAYLQQRLHEAVGEVRGVGMLAALEFMADKGARTVAAAALEDGLIVRALPGDILGFAPPLVTTRAEVDEIVAIAKEAFDEVA 469
22 -85.7005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  24  17.DFDQLFEQDRAHFMHPSTHAHDHGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGY-GRTEVADAIYKQAKELAYYHTYVHSTEAIIELSSRIIRDWAPAGMKKVYYGLSGSDANETQIKLVRYYQKKKIISRQRGYHGSGIMTGSLTGLPS-FHQHFDLPVEGIKHTVCPHWYKAPAG----MDEAAFVRYCADELEKLILA--EGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFGRLGSKMGSQRYGMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVAMGHGWTYSGHPICAAAALANLDILENLTANAADVGAYLNQRLRETVGEVRGDGMLAALEFMADREARTVSAACLEDGMIARAMPGDILGFAPPLVLTRAEADEIVGIAKAAVDEVA 469
23 -85.7005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  27  22.QTQHWQALSREHHLAPFTDYKQLARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGY-GRKELAEVAYKQMLELPYYNLFFTAHPPALELAKAIADIAPEGM-NHVFFTGSGSESNDTVLRMVRHYQKKVVIGRWNGYHGSTVAGVSLGGMKA-LHSQGDLPIPGIVHIAQPYWYGEGGD----MSAEEFGVWAAEQLEKKILE--VGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVIVRDEIVDGEFYHGFTYSGHPVAAAVALENIRILREIVETVKAETAPYLQKRWQLVGEARGVGMVGALELVKNKKTRECREHCFRNGLIMRAVG-DTMIISPPLVITKPEIDELITLARKCLDQTA 463
24 -85.4005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  25  17.DLDQLFEMDRAHFMHPSTHAHDHGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGY-GRTEVADAIYEQAKELAYYHTVGHSTEAIIELSSRIIRDWAPAGMKKVYYGMSGSDANETQIKLVWYYQKKKIISRQRGYHGSGIMTGSLTGLPS-FHQHFDLPIERIKHTVCPHWYKAPAG----MSEAQFVRYCADELEKLILA--EGPDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFGRLGSKMGSQHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWDVPMGHGWTYSGHPICAAAALANLDILENLTGNAADVGAYLQQRLRETVGEVRGVGMLAALEFMADKDARTVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVGIAKQAVDEVA 469
25 -85.4004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  29  17.KPQSWEARAETYSLYGWTDMPSLTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGF-DHKGLIDAAKAQYERFPGYHAAFKMSDQTVMLSEKLVEVSPFDS-GRVFYTNSGSEANDTMVKMLWFLQKRKILTRWNAYHGATAVSASMTGFP--YNSVFGLPLPGFVHLTCPHYWRYGEE---GETEEQFVARLARELEETIQR--EGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKREFPHGFTASGHPVGCAIALKAIDVVMNLAENVRRLAPRFEERLKHIIGEYRGIGFMWALEAVKDKASKTIANTCTDLGLICFPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKVF 463
26 -85.3005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  24  16TSLDQLFEEDRAHFMHPSTHAHDHGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGY-GRTEVADAIYEQAKQLAYYHTYVHSTDAIIELSSRIIRDWAPAGMKKVYYGMSGSDANETQIKIVWYYNKKKIISRERGYHGSGIVTGSLTGLPS-FHQHFDLPIDRVKHTVCPHWYKAPAG----MSEAQFVAYCVEELEKLIAR--EGADTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFGRLGSKMGAQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVPMGHGWTYSGHPICAAAALANLDILERLTGNAADVGAYLQQRLHEAVGEVRGVGMLAALEFMADKDARTVSAAALEDGVIARAMPGDILGFAPPLVTTRAEVDEIVGIVKQAVDEVA 469
27 -85.2004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  31  14.QTAITRATFDEVILPVYAPA---DFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGH-CHPALVEALKSQGETLWHTS-NVFTNEPALRLGRKLIDATFAE---RVLFMNSGTEANETAFKLARHYAKTKIIAFHNAFHGRSLFTVSVGGQPK-YSDGFGPKPADIIHVPFND---------------------LHAVKAVM------DDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG-FPVSAMLTTQEIAFHVGSHGSTYGGNPLACAVAGATFDIIPEVLQGIHTKRQQFVQHLQAIFSDIRGMGLLIGAELKPKYKARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKVV 413
28 -85.1002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  22  15TTPDRVHEVLGRSMLVDGLD---IVLDLTRSGGSYLVDITGRRYLDMFTFVASSALGM-NPPALVDDREFHAELMQAALNSDVYSVAMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPYMR---------PGLDEPAMAALEAEALRQARAAFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNAVPSRLNSTWGGNLTDMVRARRILEVIEGLFERAVQHGKYLRARLDELVLDPRGRGLMCAFSLPTTADRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVVT 449
29 -85.1005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  24  16QSLDQLFEMDRAHFMHPSTHAHDHGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGY-GRTEVADAIYEQAKQLAYYHTVGHSTDAIIELSSRIIRDWAPAGMKKVYYGMSGSDANETQIKLVWYYNKKKIISRERGYHGSGIVTGSLTGLPS-FHQHFDLPIDRVKHTVCPHWYRAPAG----MSEAQFVAYCVEELEKLIAR--EGADTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKMGSQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVPMGHGWTYSGHPICAAAALANLDILENLTGNAADVGAYLQQRLHEAVGEVRGVGMLAALEFMADKDARTVSAAALEDGMIARAMPGDILGFAPPLVTTRAEVDEIVGIAKQAVDEVA 469
30 -85.1004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  29  17.KPQSWEARAETYSLYGFTDMPSLTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGF-DHKGLIDAAKAQYERFPGYHAFFRMSDQTVMLSEKLVEVSPFDS-GRVFYTNSGSEANDTMVKMLWFLQKRKILTRWNAYHGVTAVSASMTGKP--YNSVFGLPLPGFVHLTCPHYWRYGEE---GETEEQFVARLARELEETIQR--EGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKREFPHGFTASGHPVGCAIALKAIDVVEGLAENVRRLAPRFEERLKHIIGEYRGIGFMWALEAVKDKASKTIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKVF 463
31 -85.1004grx_A mol:protein length:465 Aminotransferase  ali model follow..  29  15.QPQSWEARAETYSLYGFTDMPSVTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGF-DHKGLIEAAKAQYDRFPGYHAFFRMSDQTVMLSEKLVEVSPFDN-GRVFYTNSGSEANDTMVKMLWFLQKRKILTRWNAYHGVTAVSASMTGKP--YNSVFGLPLPGFIHLTCPHYWRYGEE---GETEAQFVARLARELEDTITR--EGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFGRTGNTWGCLTYDFMPDAIISSKNLTAGFFPMGAVILGPDLAKREFPHGFTASGHPVGCAIALKAIDVVEGLAENVRRLAPRFEAGLKRIIGEYRGIGFMWALEAVKDKPTKTIANTCTDLGLICRPLG-QSIVLCPPFILTEAQMDEMFEKLEKALDKVF 461
32 -85.0003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  29  17.KPQSWEARAETYSLYGFTDMPSLTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGF-DHKGLIDAAKAQYERFPGYHAFFRMSDQTVMLSEKLVEVSPFDS-GRVFYTNSGSEANDTMVKMLWFLQKRKILTRWNAYHGVTAVSASMTGKP--YNSVFGLPLPGFVHLTCPHYWRYGEE---GETEEQFVARLARELEETIQR--EGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKREFPHGFTASGHPVGCAIALKAIDVVEGLAENVRRLAPRFEERLKHIIGEYRGIGFMWALEAVKDKASKTIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKVF 463
33 -85.0005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  17.DTDDLLEMDRAHFFHPSTHLRDHGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGY-GRTEIADAIYEQAKELAYYHTYVHSNEPIIELSERIIREWAPAGMSKVYYGMSGSDANETQIKLVWYYQKKKIISRQRGYHGSGIMTGSLTGLPA-FHNHFDLPLEPIRHTTCPHYYRAPAG----MSEAEFSRHCADELEKMILA--EGPDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFGRTGSMFGSHHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWKVPIGHGWTYSGHPICAAAALANLDIIERLTGNAADTGAYFQQRMRETVGEVRGVGLMAALEFVADKDKRTVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVDIAKQAVDAVA 469
34 -85.0005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  25  17.DYAKLFEQDRAHFMHPSTHAHDHGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGY-GRLEVADAIHEQAKQLAYYHTVGHASEAIIELSARIIRDWAPAGMKKVYYGLSGSDANETQVKLVRYYQKKKIISRQRGYHGSGIVTGSLTGLAS-FHQHFDLPVEGVKHTLCPHFYKAPAG----MDEAAFVRHCAQELENLILA--EGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFGRLGDKMGSQRHAMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVAMGHGWTYSGHPICAAAALANLDILENITANAADVGGYLNQQLRQAVGEVRGDGMLAALEFMADREARTVSAACLERGMIARAMPGDILGFAPPLVLSRAEADEVVGIAKAAVDAVA 469
35 -85.0004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  34  1MSQPITRENFDEWMIPVYAPA---PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGH-AHPELREALNEQASKFWHTG-NGYTNEPVLRLAKKLIDATFAD---RVFFCNSGAEANEAALKLARKFAKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAYND---------------------INSASALI------DDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGG-FPVGALLATEECAMTVGTHGTTYGGNPLASAVAGKVLELIPEMLNGVKQRHDWFVERLNTIFSEVRGLGLLIGCVLNADYAAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHFV 401
36 -84.9002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  40  1.....MGSDKIMYLMNTYSRF---PATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGH-SHPRLVEAIKDQAEKLIHCS-NLFWNRPQMELAELLSKNTFGG---KVFFANTGTEANEAAIKIARKYKKYRILSAHNSFHGRTLGSLTATGQPK-YQKPFEPLVPGFEYFEFNN---------------------VEDLRRKM------SEDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGG-VPIGAVIVNERAVLEPGDHGTTFGGNPLACRAGVTVIKELEGFLEEVEEKGNYLMKKLQEMVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVLQGI. 391
37 -84.7005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  28  3.SSYEKYKNAEKKFWHPMGSSAAPTLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGH-NRASVKAAIAAQLDELAYYQTDGIAHPRVFDLAERLTGMFAQERMARVLFSSGGSDAVETALKMARQYGRTRFLSLRNGYHGVHMGGTSVGGNGV-YHYNHGQLLAGCHLLDTPWLYRNPWD---CRDPQALTAHCIRQLEEQIAL--LGAQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFGRSGCMLGSRGWGVAPDILCLAKGITAGYIPLGATLFNQRIADAMIMHGYTYSGHPTACAAALAVLDIVEDLPGNAAKVGAQLLEQLQPLVGEVRGKGLMIALDLVSDKRTRQIADEARRAGVLVRPIG-NKIILSPPLTLTRDEAGLMVSALEAAFARC. 451
38 -84.7003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  34  1...KDIIELTDTYGANNYHP---LPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGH-RHPKIINALIDQANRVTLTS-RAFHSDQLGPWYEKVAKLTNKE---MVLPMNTGAEAVETAIKTARRWARAEIIVCEDNFHGRTMGAVSMSSNEE-YKRGFGPMLPGIIVIPYGD---------------------LEALKAAI------TPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILFEPGSHGSTFGGNPLACAVSIAALEVLEKLTERSLQLGEKLVGQLKEIITEVRGKGLFIGIELNEP--ARPYCEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVLS... 392
39 -84.6001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  35  8.DWRALLEAEKTLDSGVYNKH---DLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGH-GNPEVVEAVKRQAETLMAMP-QTLPTPMRGEFYRTLTAILPPEL-NRVFPVNSGTEANEAALKFARAHGRKKFVAAMRGFSGRTMGSLSVTWEPK-YREPFLPLVEPVEFIPYND---------------------VEALKRAV------DEETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-VPLGVAVMREEVAMPKGGHGTTFGGNPLAMAAGVAAIRYLTRLWERAAELGPWFMEKLRAIIREVRGMGLMVGLELKEK-AAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA... 395
40 -84.5004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  23  21VAPSAAADLNLKAHWMPFSANRNFPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGH-SRKEIADAVAKQIGTLDYSPGFQYGHPLSFQLAEKIAQMTPGTL-DHVFFTGSGSECADTSIKMARAYQKTKLIGRARGYHGVNVAGTSLGGIGG-NRKMFGPLM-DVDHLPHTLQPGMAFT---KGAAETGGVELANELLKLIELH--DASNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFGRMGKATGAEYFGVTPDIMNVAKQVTNGAVPMGAVIASSEIYDTEFGHGYTYSAHPVACAAGIAALDLLENLIQQSAELAPHFEKALHGLVIDIRNCGLAGAIQIAARDGDAEASMKLWKEGFYVRFGG-DTLQFGPTFNAKPEDLDRLFDAVGEALNGVA 462
41 -84.5003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  25  10MPTAELQALDAAHHLHPFSANNALTRVITRARGVWLNDSEGEEILDAMAGLWCVNIGY-GRDELAEVAARQMRELPYYNTFKTTHVPAIALAQKLAELAPGDL-NHVFFAGGGSEANDTNIRMVRTYEKTVIISRKNAYHGSTVASSALGGMAGMHA--QSGLIPDVHHINQPNWWAEGGD----MDPEEFGLARARELEEAILE--LGENRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYAPIGGSIVCDEVAHVEFNHGYTYSGHPVAAAVALENLRILEEILDHVRNVAAPYLKEKWEAVGEAKIVGMMASIALTPNKASRACRERCFANNLIMRHVG-DRMIISPPLVITPAEIDEMFVRIRKSLDEAQ 453
42 -84.5003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  33  2....KMDYKEQSHIIPTYKRF---DIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGY-NHAKFNAKIKAQVDKLLHTS-NLYYNENIAAAAKNLAKASALE---RVFFTNSGTESIEGAMKTARKYAGGQFIAFKHSFHGRTLGALSLTANEK-YQKPFKPLISGVKFAKYND---------------------ISSVEKLV------NEKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCG-LSVGAFVINQKVALEAGDHGSTYGGNPLVCAGVNAVFEIFEKILENVNKLTPYLEQSLDELCKKRKGLGFMQGLSLDKSVKVAKVIQKCQENALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF. 395
43 -84.5003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  23  6AGASLASQLKLDAHWMPYTANRNFPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGH-TRKEIQEAVAKQLSTLDYSPGFQYGHPLSFQLAEKITDLTPGNL-NHVFFTDSGSECALTAVKMVRAYTKTKMIGRARGYHGVNIAGTSLGGVNG-NRKLFGQPMQDVDHLPHTLLASNAYSR---GMPKEGGIALADELLKLIELH--DASNIAAVFVEPLAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASTEIYQTEFPHGYTYSAHPVACAAGLAALCLLENLVQSVAEVAPHFEKALHGIVIDIRNFGLAGAIQIAPRDGDAEAGMALWKAGFYVRFGG-DTLQFGPTFNSKPQDLDRLFDAVGEVLNKL. 447
44 -84.5003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  24  3LKNDQLDQWDRDNFFHPSTHLAQHNRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGY-GRQEIAEAIADQARELAYYHSYVHGTEASITLAKMILDRAPKNM-SKVYFGLGGSDANETNVKLIWYYEKKKIISRWRGYHGSGLVTGSLTGLEL-FHKKFDLPVEQVIHTEAPYYFRRED---LNQTEEQFVAHCVAELEALIER--EGADTIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTMFGSDHYGLEPDIITIAKGLTSAYAPLSGSIVSDKVWKVPIGHGWTYSAHPIGAAAGVANLKLLDELVSNAGEVGAYLNATMAEAVGDVRGEGLLCAVEFVKDRDSRTISAKLLEQDKIIARAMGDILGFAPPFCLTRAEADQVVEGTLRAVKAV. 456
45 -84.3006erk_A mol:protein length:451 Aminotransferase  ali model follow..  27  15MTTVSTNDFDQQHLWHPYASLPPTNIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGY-NHPKLNAAMIEQLGKMAHVMFGGLTHQPAIDLGKKLLSIVPAGL-DAIFYADSGSIAVEVALKMALQYSKCQFASTHSGYYGDTWHAMSVCDPINGMHSLYGKQLPMQHFVAAPPMGFER-----------DLTQSEREALTEFFVK--NSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFGRSGKLFACEHAAISPDIMTIGKALTGGYMTFAATLSTREIADTALMHGPTFMGNPLACAVACASIDLIYDIEARTENMQAIMNEQLAPAVKEVRCLGAVAVIELNEAVDMPIFQTLLINNGIWVRPFG-KLVYIMPPYVITDDELTTLCQALLKVVSSYL 441
46 -84.3003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  24  10.AAGAVGAAMRDHILLPAQEMAKLQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGY-GRREIVDAMAHQAMVLPYASPWYMATSPAARLAEKIATLTPGDL-NRIFFTTGGSTAVDSALRFSEFYQKKRIIVRYDGYHGSTALTAACTGRTG-NWPNFDIAQDRISFLSSPNPRHAG-----NRSQEAFLDDLVQEFEDRIES--LGPDTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKFGVVPDIITFAKGVTSGYVPLGGLAISEAVLARWFTNGYTYSNQPVACAAALANIELMEGIVDQAREMADYFAAALASLVAETRSVGLVGCVQCLLDPTRADIDERCFELGLIVRPLG-DLCVISPPLIISRAQIDEMVAIMRQAITEVS 455
47 -84.1005ghf_A mol:protein length:456 Aminotransferase class-III  ali model follow..  28  3AQPNSLEARDIRYHLHSYTDAVRLPLVIERGDGIYVEDVSGKRYIEAMSGLWSVGVGF-SEPRLAEAAARQMKKLPFYHFSYRSHGPVIDLAEKLVSMAPVPM-SKAYFTNSGSEANDTVVKLIWYRERKKIISRKRGYHGVTIASASLTGLPN-NHRSFDLPIDRILHTGCPHFYREGQA---GESEEQFATRLADELEQLIIA--EGPHTIAAFIGEPVMGAGGVVVPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNLFGSQTFDMKPDILVMSKQLSSSYLPISAFLINERVYAPTLGTGFTASGHPVAAAVALENLAIIEELVANARDRGTYMQKRLRELVGEVRGVGLIAGVELVTDKQAKTANAVLQERGVISRAMG-DTLAFCPPLIINDQQVDTMVSALEATLNDVQ 451
48 -84.0001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  26  26.RSRELMKQLNIIQNAEAVH---FFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGY-SHPALVKLVQQPQNVSTFINRPALGILPPENLRESLLSVAPKGM-SQLITMACGSCSNENAFKTIFMWPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEFV----KENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKMMTGG-FFHKEEFRPN---APYRIFNTWLGDPSKNLLLAEVINIIEDLLSNAAHAGKVLLTGLLDLISRVRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDILADFK 472
49 -83.9001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  29  5.DDATFWRNARQHLVRYGGTFE--PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGH-CHPEIVSVIGEYAGKLDHLF-SGMLSRPVVDLATRLANITPPGL-DRALLLSTGAESNEAAIRMAKLTGKYEIVGFAQSWHGMTGAAASATYSA--GRKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYLAELDYAFDLIDR------QSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGL-PLAAIVTSAAIEERGYLFYTTHVSDPLPAAVGLRVLDVVDGLVARANVMGDRLRRGLLDLIGDVRGRGLLLGVEIVKDRRTKEITRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA. 432
50 -83.9003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  24  5.QSNELNAWDRDHFFHPSTHMGTHTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGY-GRQKIADAIATQAKNLAYYHAYVHGTEASITLAKMIIDRAPKGM-SRVYFGLSGSDANETNIKLIWYYEKKKIISRWRGYHGSGVMTGSLTGLDL-FHNAFDLPRAPVLHTEAPYYFRRT---DRSMSEEQFSQHCADKLEEMILA--EGPETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAKGLTSAYAPLSGVIVADRVWQVSLGHGWTYSAHPICVAAGVANLELIDDLVTNAGETGAYFRAELAKAVGEVRGDGMLAAVEFVADKDDRVVATALAASGVIGRAMPGDILGFAPPLCLTREQADIVVSKTADAVKSVF 457
51 -83.6002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  40  4.................MNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGH-AYPKLTEALKEQVEKLLHVS-NLYENPWQEELAHKLVKHFWTE--GKVFFANSGTESVEAAIKLARKYWKWKFISFENSFHGRTYGSLSATGQPK-FHKGFEPLVPGFSYAKLND---------------------IDSVYKLL------DEETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGG-VPIGAILAREEVAFTPGSHGSTFGGNPLACRAGTVVVDEVEKLLPHVREVGNYFKEKLKELKGKVKGRGLMLGLELERE--CKDYVLKALEKGLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL.... 375
52 -83.5004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  23  7VAPPVSSELNLRAHWMPFSANRNFPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGH-SRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIAGLLPGEL-NHVFFTGSGSECADTSIKMARAYQKTKLIGRARGYHGVNVAGTSLGGIGG-NRKMFGQLM-DVDHLPHTLQPGMAFT---RGMAQTGGVELANELLKLIELH--DASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTEFSHGYTYSAHPVACAAGLAALDILDNLVQQSAELAPHFEKGLHGLVIDIRNCGLAGAIQIAPRDGDPEAGMKLWQQGFYVRFGG-DTLQFGPTFNARPEELDRLFDAVGEALNGIA 448
53 -83.5001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  24  2..TTDDLAFDQRHILHPYTSMTSPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGY-NHPQLNAAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPL-ECVFLADSGSVAVEVAMKMALQYARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG----------EWDERDMVGFARLM---AAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETCFMHGPTFMGNPLACAAANASLAILGDWQQQVADIEVQLREQLAPAVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIAPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDET 425
54 -83.4001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  24  2..TTDDLAFDERHIWHPYTSMTSPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGY-NHPQLNAAMKSQIDAMSHVMFGEITHAPAIELCRKLVAMTPQPL-ECVFLADSGSVAVEVAMKMALQYARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDG----------EWDERDMVGFARLM---AAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISDHGPTFMGNPLACAAANASLAILGDWQQQVADIEVQLREQLAPAVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIRPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDET 425
55 -83.4003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  23  27LTPEQIIAVDGAHLWHPYSSIGREPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGH-GHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAGL-DTVFFSDSGSVSVEVAAKMALQYGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVP--------------RDYDPAYSAAFEAQL---AQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTALMRGPTFMANPLACAVSVASVELLQDWRTRITELAAGLTAGLDTAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLVG 453
56 -83.3005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  24  3.MTTDDLAFDRRHIWHPYTSMTSPVFPVERAEGCELILSGGERLVDGMSSWWAAIHGY-NHPQLNAAMKTQIDAMSHVMFGGITHAPAIELCRKLVAMTPAPL-ECVFLADSGSVAVEVAMKMALQYSRQRFLTFRNGYHGDTFGAMSVCDPHNSMHSLWKGYLAENLFAPAPQSRMGG----------EWDERDMVAFARLM---AAHRHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRLFACEHAGIAPDILCLGKALTGGTMTLSATLTSRQVAETISNHGPTFMGNPLACAVANASLTLLGDWRRQVAAIEAQLREELAPAVADVRVLGAIGVVETTRPVNIAALQQFFVRQGVWVRPFG-KLIYLMPPYIIQPEQLRRLTQAVNEAVREET 427
57 -83.3004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  27  5RTTSQWRELDAAHHLHPFTDTASLARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGY-GRKDFAEAARRQMEELPFYNTFKTTHPAVVELSSLLAEVTPAGF-DRVFYTNSGSESVDTMIRMVRRYEKKTLIGRWNGYHGSTIGGASLGGMKY-MHEQGDLPIPGMAHIEQPWWYKHGKD----MTPDEFGVVAARWLEEKILE--IGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGDFNHGFTYSGHPVCAAVAHANVAALRDIVQRVKDIGPYMQKRWRETVDDVRGVGMVQAFTLVKNKAKRECRDIFFRNNLIMRACG-DHIVSAPPLVMTRAEVDEMLAVAERCLEEFE 450
58 -83.1003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  23  22LTPEQIIAVDGAHLWHPYSSIGREPVVAVAAHGAWLTDGQPIEVLDAMSSWWTAIHGH-GHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAGL-DTVFFSDSGSVSVEVAAKMALQYGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVP--------------RDYDPAYSAAFEAQL---AQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAHGPTFMANPLACAVSVASVELLQDWRTRITELAAGLTAGLDTAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLVG 448
59 -82.4004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  28  389PAREDTLDRYHQYINPMMVKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGH-NPQPVVNALKNYLDAQGPNIQYISIPEQTAKLAEVLCRLAPGNM-GRVFFSNSGTEAVEAAMKIAKASGKPGIAYLRNSYHGKTLGALSITGRDK-HRRYFTPLLDAMVEVPFGD---------------------LAALREAL-----NREDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCRADLWDRFLVHSSTYGGGNLASVVALSALREIQDLVGHAERMGAYFKQALSEIVSEVRGRGLMLGIQFDQAF-TGAVNASAREFATRLPGDWHTTWKFLPDPVQ--AHLRAAMDRMEQALGEMF 795
60 -82.2005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  24  15.TANDLLARRYATIGPHSPLFYRQPLELVSGSGVWLTDAQGKVYLDGYNN--VPHVGH-ANPAVADAIYQQLLTVNLHT--RYLNSRVVEYAEALLSKFDGAL-ERLFLTNSGSEANELALRIARHTGNTGVLVSDFSYHGNTTSLAEITT----GLTVHEPLGAHVRALRIPDVSGIAEV-----DVPVLLEQSLADVDAAIASLQAAGHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSMWGYQMFNVEPELVTMGKPMGNGH-PIGAVVTTAELLDEHNMFFNTFAGNPVSSAAGLAVLRYMEDLMAKADQLGKYIRKRLENIVGSVRGRGLFFGIDIIESDGSRNLIEDMRERGVLISRVGDNVLKMRPPLVFGREHADILLGQLELSLASLP 439
61 -81.8003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  27  11.MTKALYDRDGAAIGNLQ-KLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGY-GHPAIVAAVSAAAANPAGATILSASNAPAVTLAERLLASFPGEGTHKIWFGHSGSDANEAAYRAIVATGRSGVIAFAGAYHGCTVGSMAFSGHS---VQADAAKADGLILLPYPDPYRPYRN-------DPTGDAILTLLTEKL--AAVPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGG-LPLSAVIAPAEILDCSAFAMQTLHGNPISAAAGLAVLETIDDLPAMAERKGRLLRDGLSELIGDIRGRGLACGMELVCDRQSRELIYRAYQLGLVVYYVGGNVLEFTPPLTITETDIHKALDLLDRAFSELS 433
62 -81.5003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  28  2..THDLIEKSKKHLWLPFTQMKDYPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGH-RKKELDDAIKKQLGKIAHSTLLGMTNVPATQLAETLIDISPKKL-TRVFYSDSGAEAMEIALKMAFQYEKQKFIAMKNGYHGDTIGAVSVGSIEL-FHHVYGPLMFESYKAPIPYVYRSESG-----DPDECRDQCLRELAQLL---EEHHEEIAALSIESVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKATFFHGHSYTGNQLGCAVALENLALFENIVEQVAEKSKKLHFLLQDLVGDIRQLGFMCGAELVRSKETKEVSLKMRELGMLTRPLG-DVIAFLPPLASTAEELSEMVAIMKQAIHEVT 444
63 -81.5005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  28  5.MAGNLYGRDGAAIGSLQ-KLRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGY-GHPAIIEAVSRAAANPAGASILSASNAPAVALAERLTASFPGRGTHKVWFGHSGSDANEAAYRAITRTGRTGVIAFIGAYHGCTVGSMAFSGHS---VQADAAKADGLILLPYPDPYRPYQD-------DPTGDAVLALLKERL--AAVPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGG-LPLSAVIAPAEILDCSAFAMQTLHGNPVCAAAGLAVLETIENLTTAAERKGKLLREGLARLIGDIRGRGLACGVELVRNRQSRELIYRAYELGLVLYYVGGNVLEMTPPLTMTEDEVRHAVNLLDQAFTELS 427
64 -81.1004a0f_A mol:protein length:831 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  19  324.RLNGMAKLAGEVFWWPYTQHKLVVTVIDSRCGENFSNSSLSQQFDACASWWTQGPDPTFQAELAREMGYTAARFGHVMFPENVYEPALKCAELLLDGVGKGWASRVYFSDNGSTAIEIALKMAFRKIVVKVIALRGSYHGDTLGAMEAQAPSPYTGFLQQPWYTGRGLFLDPPTVFLSNGRDASTLARIYSAYLSKHLQEHSGVR--QSAHVGALIIEPVHGAGGMHMVDPLFQRVLVNECRNRKIPVIFDEVFTGFWRLGVETTTELLGCKPDIACFAKLLTGGMVPLAVTLATDAVFDS--LHGHSYSAHAMGCATAAKAIQWFKDTNHNITSQGKTLRELWDEAVQRVVVIGTLFALELKADASNSSLLIMLREDGIFTRPLG-NVIYLMCGPCTSPEICRRLLTKLYKRLGEFN 823
65 -80.6005dds_A mol:protein length:523 CrmG  ali model follow..  25  1MTHPSGEPVYADAVLNGWLTSMGLGVEYVRAEGNTVYDDEGREVLDHACGFGSLIFGH-NHPEIIAHAKAALDAGTVVHAQLSRQPRANQISRILNDIMRRDDRYNAIFANSGAEANEICMKHAELEERPLFLTLDGSFHGKLVGSIQLTQNEP-WRTPFTALSSPARFLPADEPELIGKIVE----DERRSVLTLSLDKDTVRVVERDFPVVAAIFVEPVRGGSGMKTVTPELAEELHRLRDTLGCPLVVDEVQTGIGRTGAFFGSALLGIRGDYYTLAKAIGGGIVKNSVALIRQDRFLPEVIHSSTFAKDGLSASIALKVLEMVERVYQRVRERGQRLEAMLESVVSAVWGTGLMLALELRDQSNATSAGFLLREHHIRVLPAGSGFLRFSPSLYITDEEIDRTETALRSLFTALR 513
66 -80.1003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  26  1.............MSNVFYRSSKPYPVAVRGEGVFLYDDAGRRYLDGSSGALVANIGH-GRAEVGERMAAQAARLPFVHGSQFSSDVLEEYAGRLARFVGLPT-FRFWAVSGGSEATESAVKLARQYGRFKVITRVPSYHGASLGSLAASGMGA-RRELYTPLMRPEAWPKLPKPDPARNGA-----------EDAEGLRALLER--EGPETVAAFMAEPVVGADAALAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIAVLGKGLAAGYAPLAGLLAAPQVYETAFMHGFTYAGHPVSVAAGLSVLDIVEDLTGAAKERGAQLLAGLQALMMQVRGTGLLLGVVLGDLATASRIGAAALKRGLITYPGSGDHLLLGPPLSITAAEVDGLLALLAGALEDV. 428
67 -50.2006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  19  5.SSENLYFQGGGHMTKNSSLLAERPRVFTAASGAWLTDESGFRWIDFDNARGSILLGH-GDPVVAEAVARAATGADGTATG---WSRRVDAVLERLHALCG--GEVVGLFRSGTAAVRAAVLAVRETGRPLLLS--AGYHGYDPMWYPSEAPLEPNADGVVDFFFDL---------------------------------GLLRELLRAPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANG-HAVSAVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVAEPQRAVREAGDRFLRHARKALDDIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERLA 388
68 -49.8005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  23  5.RSETLFNNAQKHIVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGH-SHPDVLDAVRRQLDHGLSYGA---PTALEVEMADLVCSMVPS--MEMVRMVSSGTEATMSAIRLARYTGRDSIIKFEGCYHGHSDSLLVKAGSGALTFG---PNSPGVPAAFAKHTLTLPFN--------------IEAVRKTLGEV---GKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDLSTFGKIIGGG-MPVGAFGGKREIMQQISPQAGTLSGNPLAMAAGLTTLRLISRFHDELTAYTTRMLDGLQQRADATTQAGGMFGLYFSGADAIVTFFHLMLDGGVYLAPSAFEAGFTS--IAHGDKELEITLNAAEKAFAALK 429
69 -49.7002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  24  13.GSVFWAQRARSVMPDGVTAFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGH-GHPRVNAAIAEALSHGVQYAA---SHPLEVRWAERIVAAFPS--IRKLRFTGSGTETTLLALRVARFTGRRMILRFEGHYHGWHDFSASGYNSHFD-----GQPAPGVLPETTANTLLIRPD--------------IEGMREVFANH---GSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGG-LPGGILGGREDVMGVLSRHQGTFTGNPITAAAAIAAIDTIDDVCAKINDLGQFAREAMNHLFARAYGRFSGFHLMPGLPKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRLA 436
70 -49.7003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  21  6.KSIAAFEEAQDLMVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGH-ANDRVVEALKAVAERGTSFGA---PTEIENKLAKLVIERVPS--IEIVRMVNSGTEATMSALRLARYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLG---PDSPGVPEGVAKNTITVAYN--------------LESVKYAFEQF---GDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGF-RVAYNCGQGYYGVTPDLTCLGKVIGGG-LPVGAYGGKAEIMRQVAPQAGTLSGNPLAMAAGYETLVQLTESYVEFERKAEMLEAGLRKAAEKINRAGSMIGIFFTDEPVIAAYYREMVEQGVFLPPSQFEGLFLS--TVHSDADIEATIAAAEIAMSKLK 428
71 -49.7006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  24  13.GSVFWAQRARSVMTADTRVFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGH-GHPRVNAAIAEALSHGVQYAA---SHPLEVRWAERIVAAFPS--IRKLRFTGSGTETTLLALRVARFTGRRMILRIATHYHGWHDFSASGYNSHFD-----GQPAPGVLPEIAKNTLLIRPD--------------IEGMREVFAQH---GSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGG-LPGGILGGREDVMGVLSRHQGTFTGNPITAAAAIAAIDTIDDVCAKINDLGQFAREAMNHLFARAYGRFSGFHLMPGLPKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRLA 436
72 -49.7003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  22  8.KSKTAFKEAQKLMVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGH-TNDRVVESLKKVAEYGTSFGA---PTEVENELAKLVIDRVPS--VEIVRMVSSGTEATMSALRLARYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLG---PDSPGVPEGIAKNTITVPYN--------------LESVKLAFQQF---GEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGF-RVDYNCAQGYFGVTPDLTCLGKVIGGG-LPVGAYGGKAEIMEQIAPQAGTLSGNPLAMTAGLETLKQLTDSYKNFIKKGDRLEEGISKAAEAFNRAGSMIGFFFTNEPVIASYYKGMANEGVFLPPSQFEGLFLS--TAHTDEDIENTIQAAEKVFAEIS 430
73 -49.5006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  19  5.SSENLYFQGGGHMTTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGH-GDEEVAEAIARAARGRSGVGT---AWSPVLDSLLGQLQEVCG--GDVVGLYRTGTAALRSVTCAVR-DARDRSIVLSSGYHGYDPMWHC--------DEPFTPNQHGIVEFLFD---------------------------DVLAEWLSRPEQVAAVVISPDHMHLG-----ERWYTEFTRLTKEADVPVIADEVKVGL-RYRA--GLSTPLLDPAVWIVAKCLANG-SPVAAVGGDAHLLAALEDVSFTSYFEPTAMAAATTTLRRMATPQQAIRAAGDRFIAHTRAAFANLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFEGDNQTPSAA-----TDEVVEDACGRIDRVSAALT 389
74 -49.5006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  21  11.............FPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGH-GDPVVAEAVARAATGADGTATG---WSRRVDAVLERLHALCG--GEVVGLFRSGTAAVRAAVLAVRETGRPLLLS--AGYHGYDPMWYPSEAPLEPNADGVVDFFFDL---------------------------------GLLRELLRAPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANG-HAVSAVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVAEPQRAVREAGDRFLRHARKALDDIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERLA 372
75 -49.3004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  18  24.TNAESLDGIKSVIAGGVSSSMRLPLVVRSAGGCLLRDVEDGEIIDLNMGYGPHLFGY-ADREVLDAVADQFAKGHMTGLP---HELDARAGALIAELVPG--VEQVRFANSGTEAVASALRLARTTGRTLVVTFEGHYHGWSETVLRAGKTALHMEGTRPPGALGMIPEALAHTVQLGWN--------------PDALRELFARD---GDRIAAVIVEPVLANAGVIPPAPGFLQLLRELTGRSGAMLVFDEVITGF-RVARGGAQERYGVEPDLTVLSKVMGGG-FPVAAFGGRRHAMRMLASHAGVYAGNHAALRAVVAMLGKIRSLYERLEDTGQYMEDTVREVFATINRVGTLMSVALLKGSAERRLQTLAQKEGVYFHPNALEPWFLSTA---TRDVIDKVAGALQRSLVGLG 458

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.