current user: public

If you have questions about the server, please let us know.

Query: 2epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst GHMDVLASGEKSRMLFERTKELFPGGVNSPVRAAVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAVEGLRSSLKTVLGSLast
1 -110.0002epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase  ali model  100  1GHMDVLASGEKSRMLFERTKELFPGGVNSPVRAAVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAVEGLRSSLKTVLGS 434
2 -107.0005hdm_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic  ali model follow..  41  4..KKKSFSLQKSEEAFNAAKNLMPGGVNSPVRAFKSGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTNKEKFIKFEGCYHGHANAFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDLEAVEKLFAAHKGEISAVILEPVVGNSGFIPPTPEFINGLRQLTKDNGVLLIFDEVMTGFRLAYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKQAGTYEYLDKITKELTNGILEAGKKTGHPMCGGYISGMFGFFFAEGPVYNFADSKKSDTEKFGRFFRGMLEEGVYFAPSQFEAGFTSLAHTPEDIQLTIAAAERVLSRI... 434
3 -106.0002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  42  2..TSSPFKTIKSDEIFAAAQKLMPGGVSSPVRAFKSGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMSAL... 432
4 -106.0003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  38  1....MVVKFTKSEALHKEALEHIVGGVNSPSRSFKGGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALADN 433
5 -105.0003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  43  2....GMRSYEKSKTAFKEAQKLMPGGVNSPVRAFKSMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQL-TPDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMIGFFFTNEPVINYETAKASDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTIQAAEKVFAEISR. 431
6 -105.0004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  45  1.....SNAMSKSENLYAQAQQLIPGGVNSPVRAFTGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFTNDTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL... 429
7 -105.0005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  42  2.......AMSRSETLFNNAQKHIPGGVNSPVRAFKSGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPTALEVEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVALGGAQAYYGVTPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAAGIPFVTTQAGGMFGLYFSGAAIVTFEDVMASDVERFKRFFHLMLDGGVYLAPSAFEAGFTSIAHGDKELEITLNAAEKAFAALK.. 429
8 -105.0003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  42  1.....MRKFDKSIAAFEEAQDLMPGGVNSPVRAFKSMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQL-TPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIFFTDEPVINYDAAKSSNLQFFAAYYREMVEQGVFLPPSQFEGLFLSTVHSDADIEATIAAAEIAMSKLKA. 429
9 -104.0004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  35  16..GANDADRPTNAESLDGIKSVIAGGVSSSMRAAAVPLPLVVRSAGGCLLRDVEDGEIIDLNMGYGPHLFGYADREVLDAVADQFAKGHMTGLPHELDARAGALIAELVPGVEQVRFANSGTEAVASALRLARATTGRTLVVTFEGHYHGWSETVLRAGKTARPTDVVPGALGMIPEALAHTVQLGWNDPDALRELFARDGDRIAAVIVEPVLANAGVIPPAPGFLQLLRELTGRSGAMLVFDEVITGFRVARGGAQERYGVEPDLTVLSKVMGGGFPVAAFGGRRHAMRMLAS-NEAHHAGVYAGNHAALRAVVAMLGKIRSPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMSVALLKGSAEPSAEAALVDFPRHRRLQTLAQKEGVYFHPNALEPWFLSTAHTRDVIDKVAGALQRSLVGLG.. 458
10 -102.0002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  47  2.......ERPISEAYFQEAKRHIPGGVSSPVRAFKAGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEPVVGNAGVLVPTEDFLKALHE-AKAYGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKILGGGLPAAAYAGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEEPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEGPVVTFQDARRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHREEDVEKTLEALRKAL...... 424
11 -102.0006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  32  5..NDYKRKTEGSVFWAQRARSVMPDGVTADTRVF-DPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRIATHYHGWHDFSASGYNS---HFDGQPAPGVLPEIAKNTLLIRPDDIEGMREVFAQHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGRKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPGSITRAEVARPDVKMIAAMRMALILEGVDIGGRG--SVFLSAQHEREHVEHLVTTFDRVLDRLADE 438
12 -102.0002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  33  5..NDYKRKTEGSVFWAQRARSVMPDGVTADTRAF-DPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRFEGHYHGWHDFSASGYNS---HFDGQPAPGVLPETTANTLLIRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGRKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPGSITRAEVARPDVKMIAAMRMALILEGVDIGGRG--SVFLSAQHEREHVEHLVTTFDRVLDRLADE 438
13 -102.0002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  42  1......................MPGGVSSPVRAFKSGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKATTAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPVYQAGTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTIAAARTVLSQL... 411
14 -99.8002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  30  42..NTFARDNPVSAGHHERARRSMPGGNTRSILFH-RPFPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQTENEALFAEAVCDRFPSIDLVRFTNSGTEANLMALATATAITGRKTVLAFDGGYHGGLLNFA--------------SGHAPTNAPYHVVLGVYNDVEGTADLLKRHGHDCAAILVEPMLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS-RLSGGGAQEMLGISADLTTLGKYIGGGMSFGAFGGRRDLMERFDPAGAFAHAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIAVENQAPLQFTGLGSLGTIHFSRAPIRSAGDVRAADQQLKELFFFHMLRKGIYLAPRGM--YALSLEIADAGRDAFAEALADFIGEQRAL 457
15 -99.5005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  35  10..NVYREPGSAAADLFERARRVLPGGNTRTTVYS-APYPPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLADGVAFAMPTEHEIALAELLTERVPSLQQVRFTNSGTEAVMMAIKAARAYTGRPRIAKFDGCYHGSYDFAEVSTGEDGFPVATPYTGGTPQAVLDSVVVLPFNDIDGTERLIEQHRDELAAVLIDPNPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVIS-LRSDYGGMQSVLGVTPDLTAMGKIIGGGFPVGAVGGSAEVMSVFDPTGRAPHGGTFNANPVTMVAGLTAMRKL-TPAEFDRLATLGQQLRAGVEEVLREAGVPGQVTGYGSLFHIHLHQRPLADYRNSVLSERAFVGRVHEALMGRGIFITPALF--GCLSTPMGVPEVEAFVDAFAAALQDARGL 447
16 -98.4004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  30  29..RRFTDANPASQRQFEAQARYMPGANSRSVLFY-APFPLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAALHFTGRRKIVVFSGGYHGGVLGFG--------------ARPSPTTVPFDFLVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS-RLAPHGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRGPLAHSGTFNNNVMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRSSEDLAAVDGRLRQLLFFHLLNEDIYSSPRGF--VVLSLPLTDADIDRYVAAIGSFIGGHGA. 442
17 -96.5005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  25  21..RRFDELHPRSAQAYRENRRHWLYGAPLHMQQWPGNCPLLVKEAQGARVTDIDGQQYVDFALGDSGAMFGHAQPAVADAIARQARRGSTLMLPTEDSLWVGAELARR-FGLPYWQVTTSATDANRFVLRLCRMLSGRDKVVVFNCNYHGSVDESQVEFDAAGRMVPRAGVHPNGVRHATTTRLVEFNDLDALEAALAH--GDVAAVLTEPFMTNVGMVPPAEGFHAGLRELTRRHDVALIIDETHT-ISCGPAGYSGAHGLEPDFFVLGKCIAGGIPSAVWGCSQAQAERIWAVLPFGFGGTLAGNALQLAAMRATFAEVMTEDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIGARVEYLFMTHAPRNGGEAHHANGLIEACLHLYLLNRGVLLTPFH-NMALTCPATRAEDVELHDRLLRDCLGELLER 459
18 -84.6006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  22  2.......GSSSSENLYFQGGGHMTKNSSLLAERDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLL--LSAGYHGYDPMWY--------------PSEAPLEPNADGVVDFFFDLGLLRELL-RAPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTA-ELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEV-----SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEE-------------ALYGAANAEGLLFYAG--DNQGVSAAFDEAVLGEAERRFARVCERLAPY 390
19 -81.7006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  23  3..................KNSSLLAEFPTCPRDE-KDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLL--LSAGYHGYDPMWY--------------PSEAPLEPNADGVVDFFFDLGLLRELL-RAPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTA-ELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEV-----SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEE-------------ALYGAANAEGLLFYAG--DNQGVSAAFDEAVLGEAERRFARVCERLAPY 374
20 -81.0006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  20  2.......GSSSSENLYFQGGGHMDIGAGKLLAQDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDR--SIVLSSGYHGYDPMWHCDEP------FTPNQHGI---------VEFLFDLDVLAEWL-SRPEQVAAVVISPDHMHLG-----ERWYTEFTRLTKEADVPVIADEVKVGLRYRAGLST--PLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDV-----SFTSYFEPTAMAAATTTLRRMATGEPQQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVAD-------------AFHAAAAAEGLLFFEG--DNQTPSAAFTDEVVEDACGRIDRVSAALTGR 391
21 -56.7001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  22  2.........NSNKELMQRRSQAIPRGVG-------QIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFAYEPYLELCEIMNQKVPGAKKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAMPGHVYRALYPCPLHGISEDDAIASIHRIFKNDPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGG---LGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFED-----GDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRIL-EDAQIRQGLEIISQCFDEAKQ. 426
22 -55.6004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  25  25.........PKSQALAERRSAVVAAGVA-------SGVPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCTPYEGYVAVTEQLNRLTPGAKRTVLFNSGAEAVENAVKVARLATGRDAVVAFDHAYHGRTNLTMALTAKAMPYKT-PFAPEVYRMPMSYPFREENPEAKRAITMIEKQGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFRTGEWFAVDHEGVVPDIITMAKGIAGGLPLSAITGRADLLDAVHPGG---LGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAEGSVVGDIRGRGAMLAIELVQP------GSKEPNAELTKAVAAACLKEGVIILTCGTYGNVIRLL-SDELLIDGLEVLAAAIKAHA.. 456
23 -55.1001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  20  2.......SLNDDATFWRNARQHL-------VRYGGTFEPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK-LFSGMLSRPVVDLATRLANITPPLDRALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPRFERLDYAFDLIDRQSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELG-YLFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKD-----RRTKEPADGLGAKITRECMNLGLSMNIGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA... 432
24 -54.6003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  23  29.........PISQELQARKQSAVAAGVG-------VTLPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAATCFMVTPYEGYVKVAEHLNRLTPGEKRTALFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKH-PFANEVYRVPTSYPFRDGETDAHALDLINKQGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFRTGALFACEHENVVPDLIVTAKGIAGGLPLSAVTGRAEIMDGPQSGG---LGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVKPGTT------EPDADLTKRVAAAAHAQGLVVLTCGTYGNVLRFL-PDHLLDEGLDILAAVFAEVK.. 453
25 -54.3003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  23  22.........PRSQALIDRKGTAVARGVG-------TTMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDTCFMVTPYEGYVAVCEQLNRLTPVDKRSALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKVMPYKD--------GPFAPEIYRAPLSYAKRAITVIDKQADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFRTGAMFACEHEGIDPDLIVTAKGIAGGLPLSAVTGRAEIMDSPHVSG---LGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLQAEDDRIGDVRGRGAMIAMELVKA------GTTEPDADLTKALCAGAHAAGVIVLSCGTYGNVVRFL-GDDLLNEGLDVLEEVLRG.... 450
26 -54.3004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  23  17.........DKASKLIDEENKYYARSARINY------YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQK-TPAYFHHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTR-PMLPSVVHVPYPDSYRTYPGEFNEFKKPFESFADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLRTGK-AIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPA---HLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKD-----PKTKEPDSDAATKVIYYAFAHGVVIITLAGNILRFQLVIPREQLDQALQVLDDAFTAVENG 449
27 -54.2005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  22  6.......QKINWEQVKEWDRKYL----MRTFSTQNEYQPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDR-VWDTYATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSYRSGLSYNSAVLMAPSPNMFQDSDGNVKYTRRMIENYGEQVAAVITEVSQGAGSAMPP-YEYIPQIRKMTKELGVLWINDEVLTGFRTGKWFGYQHYGVQPDIITMGKGLSSSLPAGAVLVSKEIAAFMD-KHRWESVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKNFTHGMNPNQIPTQIIMKKALEKGVLIGGVMPNTMRIGLNVSRGDIDKAMDALDYALDYLESG 471
28 -54.1004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  24  25.........PRSGALAERRRAAVSAGVGST-------APVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHTCFMVTPYEQYVQVAELLNALTPGDKRTALFNSGAEAVENAIKVARLATGRPAVVAFDNAYHGRTNLTMALTAKSMPYKS-PFAPEVYRMPASYPLRDEPG-ISRIETQIG--AQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFRTGAWFASEHEGIVPDIVTMAKGIAGGMPLSAVTGRAELMDAVYAGG---LGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVKP------GTLEPDAALTKSIAAEALSQGVLILTCGTFGNVIRLL-GDDLLDEGITALSDIIRAKASH 452
29 -54.0005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  23  6.......QKINWEQVKEWDRKYL----MRTFSTQNEYQPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDR-VWDTYATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSFRSGLSCSSAVLMAPSSNTFQDSNGNVKYTRRMIENYGEQVAAVITEVSQGVGSTMPP-YEYVPQIRKMTKELGVLWISDEVLTGFRTGKWFGYQHYGVQPDIITMGKGLSSSLPAGAVVVSKEIAAFMD-KHRWESVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKNFRHGMNPNQIPTQIIMEKALEKGVLIGGAMPNTMRIGLNVSRGDIDKAMDALDYALDYLESG 471
30 -53.7003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  25  33.........PASLELNKRRAAAVSGGVG-------VTLPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQTCFMVTPYEQYVAVAEQLNRITPGEKRTVLFNSGAEAVENSIKVARAHTRKQAVVAFDYAYHGRTNLTMALTAKSMPYKS-PFAPEIYRAPVSYPYRDNLLDAERAINLIDKQAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFRTGAMFACDHENVEPDLIVTAKGIADGFPLSAVTGRAEIMDAPHTSG---LGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQAADDRLGDVRGRGAMIAMELVKS------GTAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIRLL-SDELLSEGLDILCQILAD.... 461
31 -53.6005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  22  14.........QTANDLLARRYATIGPHSPLFYR-----QPLELVSGSGVWLTDAQGKVYLDGYN--NVPHVGHANPAVADAIYQQLLTNLHTRYLNSRVVEYAEALLSKFDGLERLFLTNSGSEANELALRIARQHTGNTGVLVSDFSYHGNTTSLAEITTAHVRALRIPDVSGIAEVDVPVLLEQSLADVDAAIASLQAAGHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFRTGSG-GYQMFNVEPELVTMGKPMGNGHPIGAVVTTAELLDEFGRHNM--FFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIAQRSGNVGSVRGRGLFFGIDIIES-----DGSRNPAPALTKILIEDMRERGVLISRVGPHDNVLKMR-GREHADILLGQLELSLASLPQP 441
32 -53.6004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  25  29.....EEMKALNREVIEYFKEHVNPGFLEYRKSVTAGGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRKPF-------MPLLPGFRHVPFGNIEAMRTALNECGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLF-DNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIG-------------YNFASEMFRQRVLVAGTLNNAKTIRIE-TIEQCELVIKAARKALAAMRVS 455
33 -53.3003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  23  10.........HMTKALYDRDGAAIGNLQKL------RFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANATILSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADA-AKADGLILLPYPDPYRPYRNDLTLLTEKLAAPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAF----AMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCD-----RQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLEFT-TETDIHKALDLLDRAFSELSAV 435
34 -53.2005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  23  4.........AMAGNLYGRDGAAIGSLQK------LRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANASILSASNAPAVALAERLTASFPGTHKVWFGHSGSDANEAAYRAITRATGRTGVIAFIGAYHGCTVGSMAFSGHSVQADA-AKADGLILLPYPDPYRPYQDDLALLKERLAAPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAF----AMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLAERHELIGDIRGRGLACGVELVRN-----RQSREPARAETAKLIYRAYELGLVLYYVGMNGNVLEMT-TEDEVRHAVNLLDQAFTELSTV 429
35 -53.2005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  25  27.....EEMKALNREVIEYFKEHVNPGFLEYRKSVTAGGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRKPF-------MPLLPGFRHVPFGNIEAMRTALNECGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLF-DNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIG-------------YNFASEMFRQRVLVAGTLNNAKTIRIE-TIEQCELVIKAARKALAAMRQQ 453
36 -53.2004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  21  385.....IAQTPAREDTLDRYHQYINPMMVDFLK--LQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDA-IQYISIPEQTAKLAEVLCRLAPGMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSITGRDKHRRYF-------TPLLDAMVEVPFGDLAALREALNR--EDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLRTGKLFACEWDGIEPDVLMLSKSLSGGLPIGATLCRADLWQKAYGTRFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQFDQAFTGA--------------VNASAREFATRLPGDWHTTWKFLPDPVQAHLRAAMDRMEQALGEMFCM 797
37 -53.1005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  23  27.......KLDKASKLIDEENKYYARSARINY------YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQK-TPAYFHHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTR-PMLPSVVHVPYPDSYRTYPGEFNEFKKPFESFADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLRTGK-AIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPA---HLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKD-----PKTKEPDSDAATKVIYYAFAHGVVIITLAGNILRFQLVIPREQLDQALQVLDDAFTAVENG 461
38 -53.1005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  24  3.....MSETKNSEYFIELEEKHGAHN--------YHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRANSKLGEYEQKITSLL-GFDKVLPMNSGAEAVETAVKLARKWENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYPFTPGF--------IRIPYNDIAALEEVLSKEAGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIRTGKLIACHHEDVQPDILILGKALSGGMPVSAVLANNNIMDVIKPGQ---HGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLIEKTDLITKVRGKGLLNAILINDTP----------DSSTAWNLCLALKENGLLAKPTHGNIIRLALVITEEQLLDCVKIIEKTILEF... 413
39 -52.3004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  21  30.......KLKTEEDFFACDRQYVCQN--------YAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRANDVTGPACRFMAEMF-GYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGT---HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDS------------DAIDPNDVVMKLKENGILSKPTRGRVMRFILVITDEEHRDATTRIIKSFLAVEEE 438
40 -52.2001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  19  17.....VKDLKTPEDYINNELKYGAHN--------YDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRASVPLGICERYLTNLL-GYDKVLMMNTGAEANETAYKLCRKWENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFPFAPQF--------SKVPYDDLEALEEELKD--PNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGE---HGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKN------------ELVNVLDICLKLKENGLITRDVHDKTIRLTLCITKEQLDECTEIIVKTVKFFDER 426
41 -52.1005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  19  17.....KQTSAQTQHWQALSREHH-----TDYKQLNEKGARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLENLFFQTAHPPALELAKAIADIAPGMNHVFFTGSGSESNDTVLRMVRHYPQKKVVIGRWNGYHGSTVAGVSLGGMKALHSQGLPIPGIVHIAQPYWYGEGGDMAEQLEKKILEVGENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFRTGEWFGSQYYGNAPDLMPIAKGLTSGYPMGGVIVRDEIVDTLNEGGEFYHGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQELADHPLVGEARGVGMVGALEL----VKNKKTRERFENGVGMLCREHCFRNGLIMRAVGDTMIISPLVITKPEIDELITLARKCLDQTAAV 465
42 -52.0001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  23  37........PPTSDDIFEREYKYGAHN--------YHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRANNVLGEYEEYITKLF-NYHKVLPMNTGVEAGETACKLARKWKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFPFMPGF--------DIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLRTGRWLAVDYENVRPDIVLLGKALSGGLPVSAVLCDDDIMLTIKPGE---HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKL--PSDVVTAVRGKGLLNAIVIKETKDWDAWKVCL-----------RLRDNGLLAKPTHGDIIRFPLVIKEDELRESIEIINKTILSF... 439
43 -52.0003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  22  5.......KTKQTDELLAKDEQYV-----HGMRPFSPNSTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQT-FPMSQSHEPAIKLAEKLNEWLGGEYVIFFSNSGSEANETAFKIARQYYHRYKFMSRYRGYHGNTMATMAATGQAQRRYQYPFASGFLHVTPPDCYRMPGIEVKEVDRVMTWELETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFRTGKAFGFMNYDVKPDIITMAKGITSAYPLSATAVKREIYEAFKGKGEFRHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGIEL----VNDKETKEPIDNDKIASVVNACKEKGLIIGRNGMTTAGYNLVISSEEIAFVIGTLKTAMERI... 452
44 -51.8004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  22  12........TEQTAITRATFDEVILP--------VYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVNEPALRLGRKLID-ATFAERVLFMNSGTEANETAFKLARHYPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADI--------IHVPFNDLHAVKAVMD---DHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGS---HGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLY-----------AGAEAGVMVLNAGADVMRFSLVVEEADIHEGMQRFAQAVGKVVAL 415
45 -51.8004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  21  15.......KLKTEEDFFACDRQYVCQN--------YAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRANDVTGPACRFMAEMF-GYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGT---HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDS------------DAIDPNDVVMKLKENGILSKPTRGRVMRFPLVITDEEHRDATTRIIKSFLAVEEE 423
46 -51.6003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  21  2...DFVKELKSSQDYMNNELTYGAHN--------YDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRASDSLGVCERYLTN-LFGYDKVLMMNTGAEASETAYKLCRKWENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFPFVPNF--------LKVPYDDLEALEKELQD--PNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLRTGKLLCTHHYGVKPDVILLGKALSGGYPISAILANDDVMLVLKPGE---HGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKN------------DLVNVWDICLKFKENGLITRSVHDKTVRLTLCITKEQLDECTEIIVKTVKFFDDN 413
47 -51.5001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  28  3.....TRTLEDWRALLEAEKTLDSG--------VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQPTPMRGEFYRTLTAILPPLNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPF-------LPLVEPVEFIPYNDVEALKRAVD---EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGG---HGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPK---REVRGMGLMVGLELKEKAAPY--------------IARLEKEHRVLALQAGPTVIRFPLVIEKEDLERVVEAVRAVLA..... 395
48 -51.4003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  20  6.....ITNHMPTAELQALDAAHH-----SANNALGEEGTRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRENTFFKTTHVPAIALAQKLAELAPGLNHVFFAGGGSEANDTNIRMVRTYPEKTVIISRKNAYHGSTVASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMARELEEAILELGNRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFRTGNWFGTQTMGIRPHIMTIAKGLSSGYPIGGSIVCDEVAHVIG-KDEFNHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASR-AKFASEPGTIGYICRERCFANNLIMRHVGDRMIISPLVITPAEIDEMFVRIRKSLDEAQAE 455
49 -51.1004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  25  2..........SQPITRENFDEWMIP--------VYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGNEPVLRLAKKLID-ATFADRVFFCNSGAEANEAALKLARKFSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFPLPADI--------RHAAYNDINSASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGT---HGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQ-----------EAAKAGVMVLIAGGNVVRFALNVSEEEVTTGLDRFAAACEHFVSR 403
50 -50.5005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  16.........TDFDQLFEQDRAHF---THAHDHASGALPGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKEHTYVGHSTEAIIELSSRIIRDWAGMKKVYYGLSGSDANETQIKLVRYYNQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFLPVEGIKHTVCPHWYKAPAGMADELEKLILAEGDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFRLGSKMGSQRYGMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIEKAGAMGHGWTYSGHPICAAAALANLDILERENLTANAADVGAYLNQRLRETFEGHPLVGEVRGDGMLAALEFMAD--REARTPFDPALKVGPKVSAACLEDGMIARAMPHGDILGFAP-TRAEADEIVGIAKAAVDEVAGE 471
51 -50.5005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  22  16.........TSLEQLLEMDRAHF---THAYDHASGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQHTYVGHSNDPVIELSSRIIEDWAGMKKVFYGMSGSDANETQIKLVWYYNNKKKIIARERSYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYNAPPGMVEELEKLIAREGDTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFRLGSKTGSEHYGIKPDLITVAKGLTSAYPLSAVIVSEKVWDVIEKGGVMGHGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KGARTPFDPALKVSQKVAAAALEDGLIVRALPHGDILGFAP-TRAEVDEIVAIAKEAFDEVADA 471
52 -50.5005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  20  16.........TDTDDLLEMDRAHF---THLRDHASGELPGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKEHTYVGHSNEPIIELSERIIREWAGMSKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPAFHNHFLPLEPIRHTTCPHYYRAPAGMADELEKMILAEGDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFRTGSMFGSHHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWKVLEQGGPIGHGWTYSGHPICAAAALANLDIIERENLTGNAADTGAYFQQRMRETFGDHPLVGEVRGVGLMAALEFVAD--KDKRTRFDPSLKVGPRVSAACLEDGMIARAMPHGDILGFAP-TRAEVDEIVDIAKQAVDAVADE 471
53 -50.5005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  22  16........TSLDQLFEEDRAHFMHPSTHAHDHASGALPGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQHTYVGHSTDAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKIVWYYNNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYKAPAGMVEELEKLIAREGDTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFRLGSKMGAQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAAALEDGVIARAMPHGDILGFAP-TRAEVDEIVGIVKQAVDEVADE 471
54 -50.4005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  22  13.....SHMQSLDQLFEMDRAHFMHPSTHAHDHASGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQHTYVGHSTDAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKLVWYYNNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYRAPAGMVEELEKLIAREGDTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFRLGSKMGSQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAAALEDGMIARAMPHGDILGFAP-TRAEVDEIVGIAKQAVDEVADE 471
55 -50.4004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  20  16.........NKPQSWEARAETYS-----TDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERHAAFGKMSDQTVMLSEKLVEVSPFSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGATAVSASMTGFPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKD--KASKTPFDGNLSVSERIANTCTDLGLICFPLGQSVVLCPFILTEAQMDEMFDKLEKALDKVFAE 465
56 -50.3005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  21  16.........TDYAKLFEQDRAHF---THAHDHASGALPGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQHTYVGHASEAIIELSARIIRDWAGMKKVYYGLSGSDANETQVKLVRYYNQKKKIISRQRGYHGSGIVTGSLTGLASFHQHFLPVEGVKHTLCPHFYKAPAGMAQELENLILAEGDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFRLGDKMGSQRHAMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIDSAGAMGHGWTYSGHPICAAAALANLDILERENITANAADVGGYLNQQLRQAFEGHPLVGEVRGDGMLAALEFMAD--REARTPFDAALKVGPKVSAACLERGMIARAMPHGDILGFAP-SRAEADEVVGIAKAAVDAVAAE 471
57 -50.3005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  20  13.....SHMTDLDQLFEMDRAHFMHPSTHAHDHASGALPGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKEHTYVGHSTEAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFLPIERIKHTVCPHWYKAPAGMADELEKLILAEGDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFRLGSKMGSQHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLRETFGGHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAACLEDGMIARAMPHGDILGFAP-TRAEVDEIVGIAKQAVDEVADE 471
58 -50.2004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  18  1.....MQKQRTTSQWRELDAAHH-----TDTASLNQAGARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEENTFFKTTHPAVVELSSLLAEVTPGFDRVFYTNSGSESVDTMIRMVRRYPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGLPIPGMAHIEQPWWYKHGKDMARWLEEKILEIGDKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFRTGEWFGHQHFGFQPDLFTAAKGLSSGYPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKN--KAKRELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPLVMTRAEVDEMLAVAERCLEEFEQT 452
59 -50.1004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  20  16.........NKPQSWEARAETYS-----TDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKD--KASKTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKVFAE 465
60 -50.1004grx_A mol:protein length:465 Aminotransferase  ali model follow..  20  8...QFEKGANQPQSWEARAETYS-----TDMPSVHQRGTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRHAFFGRMSDQTVMLSEKLVEVSPFNGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFIHLTCPHYWRYGEEGARELEDTITREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFRTGNTWGCLTYDFMPDAIISSKNLTAGFPMGAVILGPDLAKRVEAAEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKR-IADRPNIGEYRGIGFMWALEAVKD--KPTKTPFDANLSVSERIANTCTDLGLICRPLGQSIVLCPFILTEAQMDEMFEKLEKALDKVFAE 463
61 -50.1003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  20  12.....RGSMNKPQSWEARAETYS-----TDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKD--KASKTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKVFAE 465
62 -49.8003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  22  15..................................YKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSNLNENIAAAAKNLAK-ASALERVFFTNSGTESIEGAMKTARKYAKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFPLISGV--------KFAKYNDISSVEKLVN---EKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSLEAGD--HGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKSVKV-------------AKVIQKCQENALLLISCGENDLRFPLILQKEHIDEMSEKLRKALKSF... 395
63 -49.6004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  23  44..................................FHKDPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGT-PGFQYGHPLSFQLAEKIAQMTPTLDHVFFTGSGSECADTSIKMARAYAQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGPLMDVDHLPHTLQPGMAFTKANELLKLIELHDSNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFRMGKATGAEYFGVTPDIMNVAKQVTNGAPMGAVIASSEIYDTFEYAVEFGHGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGLKGTKNVI-DIRNCGLAGAIQIAARD--------GDAIVRPFEASMKLWKEGFYVRFGGDTLQFGTFNAKPEDLDRLFDAVGEALNGVA.. 462
64 -49.5002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  25  13..................................YSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLNRPQMELAELLSK-NTFGGKVFFANTGTEANEAAIKIARKYEKKYRILSAHNSFHGRTLGSLTATGQPKYQKPFPLVPGF--------EYFEFNNVEDLRRKMS---EDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVN-ERANVLEPGD---HGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSN-------------REVATKCFENKLLVVPAGNNTIRFPLTVEYGEIDLAVETLKKVLQGI... 391
65 -49.5005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  24  2.........GSSYEKYKNAEKKF-----GSSAAPHRDKTLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDEQTFDGIAHPRVFDLAERLTGMFARMARVLFSSGGSDAVETALKMARQYPGRTRFLSLRNGYHGVHMGGTSVGGNGVYHYNHQLLAGCHLLDTPWLYRNPWDCIRQLEEQIALLGQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFRSGCMLGSRGWGVAPDILCLAKGITAGYPLGATLFNQRIADAIENGQGIMHGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLVERYAVVGEVRGKGLMIALDLVSD--KRTRQPLDPAAGQPSRIADEARRAGVLVRPIGNKIILSPLTLTRDEAGLMVSALEAAFARC... 451
66 -49.4003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  23  3........LKNDQLDQWDRDNFFHPSTHLAQHARGESANRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQAREHSYVGHGTEASITLAKMILDRAPKMSKVYFGLGGSDANETNVKLIWYYNEKKKIISRWRGYHGSGLVTGSLTGLELFHKKFLPVEQVIHTEAPYYFRREDLNVAELEALIEREGDTIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFRLGTMFGSDHYGLEPDIITIAKGLTSAYPLSGSIVSDKVWKVLEQGGPIGHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEALSQHANVGDVRGEGLLCAVEFVKD--RDSRTFFDAADKIGPQISAKLLEQDKIIARAMPQGDILGFA-TRAEADQVVEGTLRAVKAV... 456
67 -49.4003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  19  1......GMLNQSNELNAWDRDHF---THMGTHARGESPTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNHAYVGHGTEASITLAKMIIDRAPKMSRVYFGLSGSDANETNIKLIWYYNEKKKIISRWRGYHG---SGVMTGSLTGLDLFHNAFDLPRAPVLHTEAPYYFRRADKLEEMILAEGETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFRLGTMFGSDHYGIKPDLITIAKGLTSAYPLSGVIVADRVWQVLVQGGSLGHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVAD--KDDRVFFDASQKIGPQVATALAASGVIGRAMPQGDILGFAP-TREQADIVVSKTADAVKSVFAN 459
68 -49.1004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  23  30..................................FQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGT-PGFQYGHPLSFQLAEKIAGLLPELNHVFFTGSGSECADTSIKMARAYPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRANELLKLIELHDSNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFRLGTYSGAEYFGVTPDLMNVAKQVTNGAPMGAVIASSEIYDTFEHAVEFSHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQGAKNVI-DIRNCGLAGAIQIAPRD--------GDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGTFNARPEELDRLFDAVGEALNGIA.. 448
69 -49.0002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  28  1............................TYLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSNENPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYKNKWKFISFENSFHGRTYGSLSATGQPKFHKGF-------EPLVPGFSYAKLNDIDSVYKLLD---EETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIRTGEFYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGS---HGSTFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELGKGK-----VKGRGLMLGLELEREC---------------KDYVLKALEKGLLINCTAGKVLRFPLIIQKEHIDRAISVLREIL...... 375
70 -49.0006erk_A mol:protein length:451 Aminotransferase  ali model follow..  19  41......................................NIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGK-MFGGLTHQPAIDLGKKLLSIVPGLDAIFYADSGSIAVEVALKMALQYPSKCQFASTHSGYYGDTWHAMSVCDPINGMHSLPMQHFVAAPPMGFERDLTQSEREALTEFFVKNSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFRSGKLFACEHAAISPDIMTIGKALTGGMTFAATLSTREIADTISDYPALMHGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPAVSLEGVK-EVRCLGAVAVIELNEAVDM-------------PIFQTLLINNGIWVRPFGKLVYIMPYVITDDELTTLCQALLKVVSSYLTR 443
71 -49.0001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  22  26......................................VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFRTGKLFACEHAEIAPDILCLGKALTGGMTLSATLTTREVAETIGEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVA-DVRVLGAIGVVETTHPVNM-------------AALQKFFVEQGVWIAPFGKLIYLMPYIILPQQLQRLTAAVNRAVQDETFF 427
72 -49.0001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  22  26......................................VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-MFGEITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFRTGKLFACEHAEIAPDILCLGKALTGGMTLSATLTTREVAETIGEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVA-DVRVLGAIGVVETTHPVNM-------------AALQKFFVEQGVWIRPFGKLIYLMPYIILPQQLQRLTAAVNRAVQDETFF 427
73 -48.9003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  21  5.....NDATNAAGAVGAAMRDHI-----QEMAKLGKSAQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMV-SPWYMATSPAARLAEKIATLTPGLNRIFFTTGGSTAVDSALRFSEFYPQKKRIIVRYDGYHGSTALTAACTGDRISFLSSPNPRHAGNRSQEAFLDDLVQEFE--DRIESLGPDTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFRCGE-ASEKVFGVVPDIITFAKGVTSGYPLGGLAISEAVLARISGESWFTNGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALAS-LRDLPGVAETRSVGLVGCVQCLLDPTR--ADGTAEDKAFTLKIDERCFELGLIVRPLGDLCVISPLIISRAQIDEMVAIMRQAITEVSAA 457
74 -48.8005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  22  28......................................VFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYESRQRFLTFRNGYHGDTFGAMSVCDPHNSMHSLAENLFAPAPQSRMGGEWDERDMVAFARLMAAHRHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFRTGRLFACEHAGIAPDILCLGKALTGGMTLSATLTSRQVAETIGEAGCFMHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPAADSPQVA-DVRVLGAIGVVETTRPVNI-------------AALQQFFVRQGVWVRPFGKLIYLMPYIIQPEQLRRLTQAVNEAVREETF. 428
75 -48.8003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  24  15..................................YHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRASDQLGPWYEKVAK-LTNKEMVLPMNTGAEAVETAIKTARRWANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFPMLPGI--------IVIPYGDLEALKAAIT---PNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLRTGKVFACDWDNVTPDMYILGKALGGGFPISCAAANRDILGVFEPGS---HGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPA---------------RPYCEQLKAAGLLCKETHENVIRIALVISEEDLEWAFQKIKAVLS..... 392

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.