current user: public

If you have questions about the server, please let us know.

Query: 2fm1_A mol:protein length:355 L-allo-threonine aldolase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MGSDKIMIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFSLast
1 -113.0002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model  100  1MGSDKIMIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS 349
2 -102.0004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  42  1......MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDD--IHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQEDHDNTAWMAEQLREAGADV--MRQDTNMLFVRVGEENAA--ALGEYMKARNVLIN--ASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR.. 333
3 -102.0003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  43  1......MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDD--IHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDNAAWMAEQLREAGAD--VMRQDTNMLFVRVGEENAA--ALGEYMKARNVLIN--ASPIVRLVTHLDVSREQLAEVAAHWRAFLAR.. 333
4 -102.0003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  44  1.GSHMRYIDLRSDTVTQPTDAMRQCMLHAEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPD--DVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALPGILDLAQVQTNMVFLQLTSGESA--PLLAFMKARGILFS--GYGELRLVTHLQIHDDDIEEVIDAFTEYLGA.. 341
5 -96.2001v72_A mol:protein length:356 Aldolase  ali model follow..  21  4.TSRPPALGFSSDNIAGASPEVAQALVKHSSGQGPYGTDELTAQVKRKFCEIFERDVEVFVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNGKLMTVDGPAAKLDIVRLRERTREKVGDVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSAMIDALL-----AGFGFYHDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ 354
6 -94.6005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  22  2...TDKSQQFASDNYSGICPEAWAAMEKANHGHDAYGDDQWTERASEYFRNLFETDCEVFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGKLLTAASVNGKLTPQSIREVALKRQ-DIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAEWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANAQLLALLVSDLPGVELMFPVEANGVFLQMPE------HAIEALRAKGWRFYTFGSGGARFMCSWDTEEERVRELAADIRSIITA.. 346
7 -92.1001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  16  10.AAKPKPYSFVNDYSVGMHPKILDLMARDNMTQHAYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEATGH-KVVTAPCPDGKLRVADIESALHENR-SEHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTDIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLFFGAHSNKMAAILKAGLEACGIRL-AWPSASNQLFPILENTMIA--ELNNDFDMYTVEPLKDGTCIMRLCTSWATEEKECHRFVEVLKRLVASTA 359
8 -89.1003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  20  5LRTSFQQTTGQISGRNVGVLKTAFAAVADEMASDQYGTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEIKAL--------PDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVTTPEVPVSNMFHLHFDGQAADISPLEQVQEETGLGFVGYVDKDGYCSTEISVGDAYGELDQQTRDAGFARLR 353
9 -88.0003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  21  8.TSYQKTPYKLGGNGPRNVGVLTEALQNDNLESDIYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWAKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDDIKSLR-------EPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVTVPEVPVSNMFHVYFENSADEIGALTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPALELVFRCLE 356
10 -58.3001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  19  38LNSKDIYIDLLTDSGTNAMSDKQWAG--MMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDKGDIDLKKLQKLI--DEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRLGDKLKAAGVPI-VEPVGGHAVFLDARRRSMERGIISAGRNNVTGEHHRPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH.. 430
11 -58.0002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  19  41LDSEDVFIDLLTDSGTGAVTQSMQAA--MMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSNYFFDTTQGHSQINGCTVRNVYIKEGNFDLEGLERGIEEV--GPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQRTRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG--VVCQQAGGHAAFVDAGKLLPHIPAACELYKVAGIRAVEIGSELLRLTIPRATTQTHMDFIIEAFKHVKENAS 447
12 -57.6006MME Entity 1(prereleased)  ali follow..  19  38LNSKDIYIDLLTDSGTNAMSDKQWAG--MMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDKGDIDLKKLQKLID--EKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRLGDKLKAAGVPI-VEPVGGHAVFLDARRRSMERGIISAGRNNVTGEHHRPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH.. 430
13 -57.4001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  19  38LNSKDIYIDLLTDSGTNAMSDKQWAG--MMIGDEAYAGSENFYHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMTTTRFHQEKNGATFVDIVRDEAHDASLNKGDIDLNKLATLIKEKGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLRYIEHRVKQVRYLGDKLREAGVPI-VEPTGGHAVFLDARRFCPHLTQAASIYMETGVRSMERGIETVRLTIPRRVTYAHMDVVADGIIKLYQH.. 430
14 -52.5001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  18  37FLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFTAAHVELNGCKAINIVTEKGDFDIKKLKENIAQHGAD--NIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARIFDMYKYADALTMSAKKDPLLNIGGLVADNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYGQVKYLGDRLREAGIPI-QYPTGGHAVFVDCKKLVPQIPGINALYLESGVRAVEIGSEFMRLTIARRVTNDHMDYIADALIGLKEKFA 442
15 -26.6002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  14  48.................................DEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETK--KRGEVVLALITYPDGNYGNL---PDVKKIAKVCSEYDVPLLVNGA---YAIGRMPVSLKEI--GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVEL-ITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKLYRELKSRKIHGIKPGLTRYFKLSTYGLSDEEVDYVLNAFKEIIEKYS 371
16 -26.3005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  17  46...TREFINLNPIQRGGILPEAKKAVYEYWDGYSV--TCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEYPTYKINLEGYKEVIDNLEDKGKNVGLILLTHVDGE--GNLND---AKKVGKIAKEKGIPFLLNCAY---TVGRMPVNGKEV--KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEMLGCTSRGLPIVTMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKHDLIKFETPVDKRRGFFFYDELKKRGIGGIRAGVTKEIKMSVYGLEWEQVEYVVNAIKEIVESCK 411
17 -25.1003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  19  30..EDGNIFGSMCSNVLPITRKIVDIFLETNLGD--PGLFKGTKLLEEKAGSLLNNKDAHIVSGGTEANLMALRCIKNIWREIIVPITAHFSFEKG---REMMDLEYIYAPKEDYTIDEKFVKDAVEDY------DVDGIIGIAGTTELGTI---DNIEELSKIAKENNIYIHVDAA-LDDKYKKKGVNYKDFSLGVDSITIDPHKMGHCPSGGILFKDIGYKRYLDVDAPYLTETRTRVGFGGACTYAVLEGQRKIVNECMENTLYLYKKLKENNFKPVIEPILNIVAI-----EDEDYKEVCKKLRDRGIYVSVCNVKALRIVVMPHIKREHIDNFIEILNSIKRD.. 397
18 -24.3002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  15  122......................................ASIMYALTNKIFKQLGLNVATPISTGMSISLCLSAARKKYGSVVIYPYASHKSPIKAVSFVGMNMRLVETVLGDRVYVPVEDIENAIKKEIE--LGNRPCVLSTLTFFPPRNS---DDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGVYSTDAEFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDDYIVMNAAIGVRTEDIVNSVSKLEKIL.... 449
19 -24.1001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  17  41VADGSHVINFCANNYLG-HPDLIAAAKAGASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDG---VRLCKAKRYRYANND----MQELEARLKEAREAGARHVLIATDGVFSMDG----VIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVML---GDAVVAQKFARELQKEGIYVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLG 398
20 -24.0003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  16  41..GEKEVLNFCANNYLG-HPALIKTAQTVASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDG---IRLCKAQRYRYKNNA----MGDLEAKLKEADEKGARFKLIATDGVFSMDG----IIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLEEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVML---GDAQLATNMADHLLQEGIYVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLG 397
21 -23.9004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  15  96...........EEKLTELLVKAYGDFAWSNPLH--PDIFPGLRKIEAEICSLFNGGPGCVTSGGTESILMACKAYRDLAFEIVAPQSAHAAFNKA---ASYFGMKIVRVPTKMMEVDVRAMRRAISRN-------TAMLVCSTPQFPHGVI---DPVPEVAKLAVKYKIPLHVDAC--LGGFLIVFMEKAGYVKGVTSISADTHKYGYAPSSLVLYSDKKYRNYQFFVDTDSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRD--FDIYRLSNLMTAKGWNLNQLQPPSIHFITLLHARKRVAIQFLKDIRESVTQIM 455
22 -23.8002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  19  42..NGRKTILLGTYNYMG-DPDVIAAGKQATGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDG---CWLGDAEIVRFRHNS----VEDLDKRLGRLPAE--AGKLVVLEGVYSMMG----DIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEVEADVDFVVGTFSKSVGT-VGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRHAGDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTDMA-QAVALWQGLLEAGLYVTPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATG 396
23 -23.4002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  20  62..RGKDTILLGTYNYMG-DPDVIAAGKEANGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDG---CQQGNAEIVRFRHNS----VEDLDKRLGRLPKE--PAKLVVLEGVYSMLG----DIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSKSVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQE-QAAMMWQALLDGGLYVTPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVG 416
24 -23.4005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  12  65.........FCQTYMEPEAVELMKDTLEKNAID--KSEYPRTAEIENRCVNIIANFTGTSTIGSSEACMLAGLAMKFAWRKIVISAGYQVCWEKFCVYWDI-DMHVVPMDDDHMSLNVDHVLDYVDDYT-----GIVGIMGITYTGQYDDLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELKWLNNVISINASGHKYGLVYPGVVIWRDQQYLPKELVFKVSYLGGFSHSASQLIGQYYNFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYESDREWTLYDLSDRLLMKGWQVPTYDRVIQRIVVRADFGMSMAHDFIDDLTQAIHDLD 449
25 -23.1003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  15  117...................IAFLNEVYALQSQSNPLHPDPSTAKFEAEVVAMTGTVCGTVTSGGTESLLLAMKTYRDTAPEAVVPVSAHAAFDKA---AQYFGIKLVRTPDADYRADVAAMREAITPN-------TVVVAGSAPGYPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGATSVILYRRPDLLHYQYFIAADSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVAS---DELNIYQVMEEMAGRGWRLNGLHPPAFHVLTLRHTEPGVVDRFLADLQDAVAQVR 474
26 -23.1004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  20  78..RGKDTILLGTYNYMG-DPDVIAAGKEANGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDG---CQQGNAEIVRFRHNS----VEDLDKRLGRLPKE--PAKLVVLEGVYSMLG----DIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSASVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQE-QAAMMWQALLDGGLYVTPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVG 432
27 -22.8004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  15  97...........MPATMAILGDLVAAAVNNNML--SLEMSPSFSRLETLLAGLFGQAGGVLTSGGSLANLQALAVARNV--VIFASEAAHTSLQKAAMLLGLGTAAVIPVRTADSRMDPEDLRARIDQARGA--QHPFCVVATAGTTTTGNI---DPLAEIGAIAREHGLWFHVDAA--YGGALVFSERHRWRLAGIDSITFNPQKWLYVACAMVLFRDAGVLERAFRIPAQGTRHADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRPFLRLAGEIDTNIVCFRGEPDWLPAERLQALLLREGKIFLSLGGRWLRALLNPYTTDAVIDAMFKQIDRFAGRE. 481
28 -22.8004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  15  102...........PASSVSWLGDIMTSAYNIHAG--GSKLAPMVNCIEQEVAKQVGFTEGVFVSGGSMANITALTAARDN--TAYISDQTHSSVAKGLRIIGITDSRIRRIPNSHFQMDTTKLEEAIETDKKS--YIPFVVIGTAGTTNTGSI---DPLTEISALCKKHDMWFHIDGA--YGASVLLSPKYKSLLTGTDSISWDAHKWLFQTCAMVLVKDIRNLFHSFHVNPELTRPARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKKDWEIVSPAQMAMINFRYAPKDLTKEEISHRILESGYAAIFTGKTVLRIAIHPEATQEDMQHTIDLLDQYGREI. 483
29 -22.7003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  18  41..DGRRVLMFGSNSYLG-DTRIIKAAQDAAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDG---SRLSFSKVIKYGHNN----MEDLRAKLSRLPED--SAKLICTDGIFSMEG----DIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASLNDDVDLIMGTFSKSLAS-LGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALENEPEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFI---RSNEKTFWVTKMLQDDGVFVVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAE 393
30 -22.7002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  37..ASPDDIILQSNDYLA-HPLIKARLAKSFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNN----CDHLRMLIQR-----HGPGIIVVDSIYSTLG----TIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLGLTI---RSESQIIGLETGDER-NTEKVRDYLESNGVFGSSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGD 385
31 -22.7005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  16  113...................IAFLNEVYALQSQSNPLHPDPSTAKFEAEVVAMTGTVCGTVTSGGTESLLLAMKTYRDTAPEAVVPVSAHAAFDKA---AQYFGIKLVRTPDADYRADVAAMREAITPN-------TVVVAGSAPGFPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGAKGTILYRRPDLLHYQYFIAADWPGGGSRPGALSATAWAAMEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVAS---DELNIYQVMEEMAGRGWRLNGLHPPAFHVLTLRHTEPGVVDRFLADLQDAVAQVR 470
32 -22.6003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  18  49..PVAAELDLASNDYLG-HPDVLDGGVEAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDA---CRLSRARVVVSPHRD----VDAVDAALAAR----TEERAVVVTESVFSADGDLAP---LRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHLAGAPDIVMTTLSKALGS-QGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALR----VLDAEPQRARAVLDRAAELATIAGVTEAPVSAVVSVILGDPEIAVGAAAACLDRGVRVVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR 397
33 -22.6003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  13  69...................EPECDKLIMSSINKNYVDMDPVTTELQNRCVNMIETAVGVGTVGSSEAIMLAGLAFKRKWQNIVTGANVQVCWEKFARYFEV-ELKEVKLSEGYYVMDPQQAVDMVDEN-------TICVAAILGSTLNGEFEDVKLLNDLLVKETGWDTPIHVDAA-SGGFIAPFLYPELEWLPLVKSINVSGHKYGLVYAGIVIWRNKEDLPEELIFHINYLGAFSKGSSQVIAQYYQLEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPLVAFSDSSCHTEFEISDMLRRYGWIVPAYHITVLRVVIREDFSRTLAERLVIDIEKVMRELD 445
34 -22.4002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  12  107LHTPPLMPAVAAEAMI----------AALNQSMDSWDQASSATYVEQKVVNWLCD-DGIFTSGGTQSNQMGLMLARDW--RIVCSKKSHFTVQKSASWMGLGEKAVMTVDNADGTMDITKLDEVIAQAKAE--LIPFAIVGTAGTTDHGAI---DDLDFIADMAVKHDMWMHVDGAYGGALILSSHKSRLKGVERAHSISVDFHKLFYQTCGALLVNDKSNFKFLLHHADATTKRFDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDQFELLAEPSLSTVLFRATHETADLDELRLEALTRGIAVLGEGKTALKFILNPCLTTSDFESLLSKINMLAVEL. 496
35 -22.3003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  51..ASPDDIILQSNDYLA-HPLIKARLAKSFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNN----CDHLRMLIQR-----HGPGIIVVDSIYSTLG----TIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLGLTI---RSESQIIGLETGDER-NTEKVRDYLESNGVFGTSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGD 399
36 -22.2004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  14  117.....................LKEVYGATALTNPLHDKWPRINAMQAEVQNLFHGSKGLLTHGGTTSIIEAMAAYVIRARAIVVPETAHAAFKKAAELTGA-ILITVPVDKKTGAVNPNVMSSYITRN-------TAVMVGSAPSFMNGIH---DPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMVPGVTSISADLHKYGCCPKGTCLFSEDSPALSVYAALNWSGGLYSTSGARVAEVYATLNKYQEIAKSIIRLRNAIQKELTALVEEGNGLTGNPQWSILGFRSNTCNAHFIADELEKRGWKLNLLQN-HLCLTHVHTLVGSFETQFIKDLREAVIDVK 475
37 -21.6005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  15  61...........DHEHYAFLNEAYGLFSHVNALQ--RDLCPSMNRMESEIVALLHGEAGALSLGGTESILNATLAYREKA-RMIWPASAHPAFRKA---AHLFGFDVTVAPDPVTMQVDADFVRDAVDAN------TVMLVGSACNYPYGTI---DPIGALSAIAVEKDVWLHVDGC--LGGWMLPWGEALGYLPGVTSISADTHKFGYGPKGGLAWRDASFRRHQYFLMTDWVGGGSRSGGLIAATWAALEGYLARAKAIFETAFDMQAAVRAIPELRVLGKP---TFCFAFTSDAFDIYHVNDFMRQRGWRFNGLQPDALHMVTGPQTQPGVAERFRQDLGEAVEHAR 429
38 -21.5005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  13  110LNCPVVLPSLLAEQIM----------AAVNSSVDTWDQSAGGTLIEQKVLSRIGLPAGIFTSGGTQSNLMAMLLARDS--RVFTSKLSHFSIQKSMAILGLGYDAVIPVDDERYRMDVDCLKQEVQRCLQQ--LIPVAVVATSGTTDFGSI---DPLGAISELCKHHGMWMHVDAA--YGCGLLVSESHRPRLAGIDSVTVDYHKSFFQTCGAFFVRDKHHLSHVTHHADQTTRRFDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPAIEVLHVPELTTQIFRYVPRPGMNDAIRKAVFRSGNAVIAGGRQYLKFLLNPNTTAADIEDVIALIVHYGREQ. 508
39 -21.5001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  16  37..DDRQYLNFSSNDYLG-HPQIIRAWQQGGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEA---ASLSPSQLRRFAHND----VTHLARLLASPC---PGQQMVVTEGVFSMDG----DSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWQKVKPELLVVTFGKGFGV-SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIV---GDNSRALQLAEKLRQQGCWVVPAGTARLRLTLTAAHEMQDIDRLLEVLHGN..... 383
40 -21.2003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  13  82....................DISAVQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVEGDELRTDLKAVEAKIQELGPE----HILCLHSTTACFAPRV--PDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLIQQGARVGIDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTTQLGSMLFTRQVSGARAVPLGNVQMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVR 444
41 -21.2005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  15  39..DGRAIIGFASNDYLG-HPQLIAAIAEGGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDG---ARLSRADVQIYPHCD----TDALSAMLEASD---ADVKVIVSDTVFSMDG----DIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIALRSPNLISIGTLDKAAGV-SGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLII---GANDATLEIAATLDRAGLWVVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA 396
42 -20.9004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  14  92...................PSLLGDMLADAINCLGWASSPACTELEMNVAKMLGLPEGVLQSTVSESTLIALLAARKN--VAYASDQAHSSVEKA---GLISLVKMKFLPDDNFSLRGEALQKAIEEDKQR--LVPVFVCATLGTTGVCAF---DCLSELGPICAREGLWLHIDAA--YAGTAFLCPEFRGFLKGIDSFTFNPSKWMMVHCTGFWVKDKYKLQQTFSVNPPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNSLTENVLKEIAKAGRLFLIPDKLIIRFVTSQFTTRDDILRDWNLIRDAATLI. 478
43 -20.8005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  13  37..NGREIVGFASNDYLG-HPKLVAAFAEGGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDG---TRLSRATVQVYPHAD----TATLGALLEACT---SQTKLIVTDTVFSMDG----DIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALALRSPHLVYVGTLGXAAGV-AGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLDEGDARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVI---GSNEATLAAMRALDAHGLWVVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA. 393
44 -20.8003ju7_A mol:protein length:377 Putative PLP-dependent aminotransferase  ali model follow..  15  14.................PVIEYLDELKEIDASHIYTNYGPINQRFEQTIMSGFNRGAVTTVANATLGLMAAIQLKRKKGKYALMPSFTFPATPLA---AIWCGLEFIDISIDDWYMDKTVLWDKIEELKEEVAIVVPYAT--------GSWMNLEEYEELE----KKGVPVVVDAAPGFGLMNG-GMHYGQDFSGMIIYSFHATKPFGI-GGLIYSKNEEDIQRIKRMGNMMGFNCKMSEYAAAIGIATMKKWDDKLKERTRISEWYKQLLQSNGLMKKGWQLQKQQFMPILCPEEVRNKQVIEDLKKQKIRTNKIAKRIVSLPLWEGMTKEIVEQIVICLGQKVVS.. 374
45 -20.8006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  13  99...........SSSNAGLLGELLCSGLSVIGF--TWSSSPAATELENVVAKMLNLPSGVLQANTCEAVLCTLAAARDK--VLYCSDQTHFTIHKGAKLIGIRSKNIKSITTKKEKLCPNDLRDAIR-SDLEAGLVPFYVCGTIGTTALGVV---DPIKELGKVAREFDLWLHVDGA--YGGSACICPEFQHYLDGVDSISMNAHKWLLSNCCFLWLQSPNALIESLAAEASLSRRFRAIKMWMVIRRYGVSNLIEHIRSDVSMAVRFEEMVAADDRFEIVFPRKFALVCFKLSSEKTPPGRLMERVNSSGKAYLSGRIFFIRCIGSSLTEERHVDNLWRLIQETAQSI. 488
46 -20.8001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  14  87...................PAMLADMLCGAIGCIGWAASPACTELETVMGKMLQLPEGVIQGSASEATLVALLAARTK--VAYASDQAHSSVERA---GLIGGVKLKAIPDGKFAMRASALQEALERDKAA--LIPFFVVATLGTTSCCSF---DNLLEVGPICHEEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKRRTDLTGAFKLDPPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSDGLNEALLERINSARKIHLVPGQFVLRFICSRKVESGHVRLAWEHIRGLAAEL. 474
47 -20.7002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  14  112...........GLDPHALAGRIITESLNTSQY--TYEIAPVFVLMEEEVRALVGWSSGIFCPGGSISNMYAVNLARYQ--ALFTSKECHYSIQKGAAFLGLGTDSVRVVKDERGKMVPEDLERQIGMAEAE--AVPFLVSATSGTTVLGAF---DPLEAIADVCQRHGLWLHVDAA--WGGSVLLSQTHRHLLDGIDSVAWNPHKLLAAGLSALLLQDTSHGSQASYLFQQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRAPVLKERMVKEGSMMIGYQPNFFRVVANSALTCADMDFLLNELERLGQDL. 509
48 -20.7004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  14  43..KDDSIIDFTTSDYLN-AHNLKHAIVNGKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDG---IKLSQAKLRRYKHQQ----LSQLQDIYDG--------KSFITTEGVFSTSGSITQLDKLAKITP-------KLIVDEAHSFGVLGKNGRGAIN-YKNCLICVFPLGKAFGG-VGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNVNDNRARLQQNITFFNELCDAKD--LELVSKDLSPIRSIQLNNANLAIRLKDKLFENKIIVVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEY 389
49 -20.7002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  16  44..GKQDITVWCGNDYLG-HPVVLAAMHEAGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVPGLIIYSDSLNHASMIEG---IKRNAGPKRIFRHND----VAHLRELIAADDPA--APKLIAFESVYSMDG----DFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAELMHRIDIFNGTLAKAYGV-FGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAEGQKLRDAQQMHAKVLKMRLKALG--MPIIDHGSHIVPVVIGDPVHTKAVSDMLLSDYGVYVVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA 401
50 -20.7003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  13  77...........GDDLIHLQTIAYEKYCVANQLH--PDVFPAVRKMESEVVSMVDTGCGTTTSGGTESLLLACLSAKMYA-EIIAPVTAHAGFDKAAYYFGM-KLRHVELDPTTYQVDLGKVKKFINKN-------TVLLVGSAPNFPHGIA---DDIEGLGKIAQKYKLPLHVDSC--LGSFIVSFMEKAGYVPGVTSISCDTHKYGFAPKGSIMYRNSDLRMHQYYVNPASRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENPDLDIMGNPRYSVISFSSKT--LNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELK 438
51 -20.6001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  13  69...................DENVHKLMDLSINKNWIDKEPQSAAIDLRCVNMVADKNGQAVGTNTIGSSEACMLGGMAMKPNLVCGPVQICWHKFARYWDV-ELREIPMRPGQLFMDPKRMIEACDEN-------TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA-SGGFLAPFVAPDIVWLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGGQSRPAGQVIAQYYEFEGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVEDPGYTLYDLSERLRLRGWQVPAFTLGVMRIMCRRGFEMDFAELLLEDYKASLKYLS 449
52 -20.6003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  12  87...................PAIVADMLSGAIACIGWIASPACTELEVVMGKMLELPAGVIQGTASESTLVALLGAKAK--VGYCSDQAHSSVERA---GLLGGVKLRSVQSENHRMRGAALEKAIEQDVAE--LIPFYAVVTLGTTNSCAF---DYLDECGPVGNKHNLWIHVDAA--YAGSAFICPEYRHLMKGIDSFNFNPHKWMLVNCSAMWLKDPSWVVNAFNVDPPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPDVYFLRMICSRFTQSEDMEYSWKEVSAAADEM. 471
53 -20.6003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  13  87...................PAMLADMLCGAIGCIGWAASPACTELETVMMDWLGEGGGVIQGSASEATLVALLAARTK--VAYSSDQAHSSVERA---GLIGGVKLKAIPDGNFAMRASALQEALERDKAA--LIPFFMVATLGTTTCCSF---DNLLEVGPICNKEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKKRTDLTGAFRLDPPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPDKFVLRFICSRTVESAHVQRAWEHIKELAADV. 474
54 -20.6003wco_A mol:protein length:392 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  13  27...............APLSKDVINFISEIANG-EEGKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKEVIISRGELVEIGGSFRIPDIMSGAILREVGYYN-KTKVSRYEGAINQN------TALLMKVHKSNFPMEGFVEEVKLEDLVKLGHKYGIPTYYDAGKEFGISVDEPNFRDCISLGIDLVSGSGDKLLGGPQAGIIVGKKNLIEKIK--KNPIARALRIDKLTLSGLEMTLKLYFEKEKALRQKAKRLEKLLKDIPGLKILPELELPTYCVAIRHDRLSSQELSRRLRLAEPPIVCRIREDQLLFDMRTVFHEDLKTIKKTLQELLS... 391
55 -20.5001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  14  69...................DENVHKLMDLSINKNWIDKEPQSAAIDLRCVNMVADKNGQAVGTNTIGSSEACMLGGMAMKWNLVCGPVQICWHKFARYWDV-ELREIPMRPGQLFMDPKRMIEACDEN-------TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA-SGGFLAPFVAPDIVWLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGGQRPAGQVIAQYYEFLEGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVEDPGYTLYDLSERLRLRGWQVPAFTLVVMRIMCRRGFEMDFAELLLEDYKASLKYLS 449
56 -20.5006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  15  94...........NSSVAGFLGEMLSAGLGIVGF--SWVTSPAATELEMIVAKLLNLPESKGNGGGVIQGSASEAVLVVLIAAVYSSDQTHSALQKACQIAGIHPENCRVLTSTNYALRPESLQEAVS-RDLEAGLIPFFLCANVGTTSSTAV---DPLAALGKIANSNGIWFHVDAA--YAGSACICPEYRQYIDGVDSFNMNAHKWFLTNCSLLWVKDQDSLTLALSTNPPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEIVTPRIFALVCFRLVPVKDEEKKLLDAVNSSGKLFMSHGKIVLRCIGAPLTEEKHVKEAWKIIQEEASYL. 487
57 -20.3005k8b_A mol:protein length:403 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase  ali model follow..  17  7.........FGPEEKQEVADVMEHGFTFRYNFDHMRNDRWKTRDMEQLLCEKMNVKHAHLLSSGTAALQTAMMAAIGAGDEVIVPPFTFVAS--VEAIFMAGAVPIFAEIDETLCLSPEGIEAVITP--------RTKAINLVH---CGSMAKMDEIKAI---CKKHNLVLLEDACQAIGGSYK-GQALGTIGD-VGCYSFDSVKTITC-GGAVITNNTEIYDNAHMFSPIMGLNFRISEMNAALGLAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDSAGFLSFMLPTEARTQEISKKLAANGVKSDAIMSRTISMLIKLSWTDAQIAERIENIKKAFAQLE 397
58 -20.3006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  16  124LYAGLDYYSLAARIIT----------EALNPSIYTYEVSPVFLLVEEAVIECVGWKEGIFNPGGSVSNMCAMNLARYR--ILFTSAECHYSMKKAASFLGIGTQNVYFVEDGRGKMIPEDLEKQIWQARQE--AVPFLVCATSGTTVLGAF---DPLDEIAEVCERHGLWLHVDAS--WGGSALVSRKHRRLLHGIDSVAWNPHKMLMAGISALLVKDKSYSAKATYLFQQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFWYIPPSLRAPAIKEKMMKKGSLMLGYQPNFFRQVISPQVSREDMDFLLDEIDSLGRDM. 524
59 -20.3003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  100....................DISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFVVPMATGMSFLTLRHKRPKAKYIIWPRIDQKSCFKS----ITAGFEPVVIEGDELRTDLKAVEAKVQE----LGPDCILCIHSTTSCFAPRV--PDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGIDAFVQSLDKNFMVPVGGAIIFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTTQLGSMLFTRQVSGARVVPLGSMQMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVR 462
60 -20.3006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  14  104...........TVSSAAFLGEMLSTALNSVGF--TWVSSPAATELEMIVAQILKLPKFSGTGGGVIQNTTSESILCTGKLVCYGSDQTHTMFPKTCKLAGIYPNNIRLIPTTVEGISPQVLRKMVEDDVAA--YVPLFLCATLGTTSTTAT---DPVDSLSEIANEFGIWIHVDAA--YAGSACICPEFRHYLDGIDSLSLSPHKWLLAYCTCLWVKQPHLLLRALTTNPATGRKFRSLKLWLILRSYGVVNLQSHIRSDVAMAKMFEEWVRSDSRFEIVVPRNFSLVCFRLKPDVSSLHKLLDMLNSTGRVYMTHGIYMLRLVGSSLTEEHHVRRVWDLIQKLTDDL. 496
61 -20.1002po3_A mol:protein length:424 4-dehydrase  ali model follow..  18  32...................ARLYERLDRALDSQWLSNGGPLVREFEERVAGLAGVRHAVATCNATAGLQLLAHA-AGLTGEVIMPSMTFAATPHA----RWIGLTFADIDPDTGNLDPDQVAAAVTP--------RTSAVVGVH----GRPCAADQLRKV---ADEHGLRLYFDAAHALGCAVD-GRPAGSLGD-AEVFSFHATKAVNA-GGAVVTDDADLAARIRALHNAGGTNAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLADLPGVLVADHDRHGIVEIDEATTGIHRDLVMEVLKAEGVHTERLAARVLSLPTGTAIGDDDIRRVADLLRLCATR.. 385
62 -20.1001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  13  154.........FRAD-LCNADVAL----------GDLLIHEGPAVAAEKHAARVYNADKTYFVLGGSNANNTVTSALVSNGDLVLFDRNNHKSVYNSA---AMAGGRPVYLQTNGGIYDSDFDEKKIREPERAKWKRPFRLAVIQLGTYDGTIY---NAHEVVKRIGHLCDYIEFDSAPMMRNSSPLLIDDLGPEDPGIIVVQSVHKQQAGFSQTSQI-HKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGIIPEKSDLNSILFLMTPAETPAKMNNLITQLLQLQRLIE 567
63 -20.1004lc3_A mol:protein length:391 Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase  ali model follow..  18  1MAMSQTTAPFLPFTRPEIDEETIQGVVEV-LRSGWITTGPQCQKFEAALSEYCGGRPVRVFNSGTCTLEIGLRIAVGPGDEVITTPASWVSTSNVGATPVFAD-----IDPVTRNIDLDKLEQAITP--------RTKAIIPVF---SGLPVDMDRLYAI---ARAHKLRVIEDAAQAFGSTWH-GKRIGAIGD-LVSFSFHANKNLTT-GGALVLNNEDEAVLAQKYRDVLGGKYNLTDVAARVGLGQLPHLERFTAQRRALARAYFAAFDGGAAAKLGVGLPVALVTLPLERLTITRAEFMAQMKERGIHAERYGASTVTLPLFTQMTEGDVRRVVDAVNQICEQYG 384
64 -20.1005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  15  54..EADKVTVWCSNDYLA-HPEVLDAMHKTKYGCGA-GHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDIFSDELNHASMIVG---IKHANVKKHIFKHND----LNELEQLLQSYPKSVP--KLIAFESVYSMAG----SVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEVMDRVDMITGTLGKSFGS-VGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRCHIDLRTSQQKHTMYVKKAFHELG--IPVIPNPSHIVPVLIGNADLAKQASDILINKHQIYVVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQ 431
65 -19.9005i90_A mol:protein length:427 PvdN  ali model follow..  15  47FDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDR---WKYEDEARAWAGRYFAPGQVALTGSTTDGAAIYGGLLVQPGKEILTSSHEHYSTYTT--RHKRMGTQVREFPLFKDPHRVSADEILSSIAAQIRPQTRVLGMTWVQSGS-GVKLPIREIGKLVR-DEQDRIIYVVDGVH---GFGVEDVSFADF--DCDYFIAGTHKWLFGPRGGVIIARSEQLQEH-SRADNFGTLMTPGGYHAFEHRLALGTAFELHARIHQLNAYLKQRLGEHPKVRLVTPTSPEL-FTFFRVEGRDCEAVAKHLMAHRVISDA-VGPVVRLAPSLLNDEAEIDRVLEILAPQLA... 427
66 -19.8002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  14  95LSTGLDMVGLAADWLT----------STANTNMFTYEIAPVFVLLEYVTREIIGWPGGIFSPGGAISNMYAMMIARFK--IAFTSEHSHFSLKKGAAALGIGTDSVILIKDERGKMIPSDLERRILEAKQK--FVPFLVSATAGTTVYGAF---DPLLAVADICKKYKIWMHVDAA--WGGGLLMSRKHKWKLSGVNSVTWNPHKMMGVPLSALLVREEGLMQNCNQMHAQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNRE-MVFDGKPQHTNVCFWYIPPSLRTPVIKARMMEYGTTMVSYQPNFFRMISNPAATHQDIDFLIEEIERLGQD.. 497
67 -19.8001mdo_A mol:protein length:393 ArnB aminotransferase  ali model follow..  18  1MAEGKMMSDFLPFSRPAMGAEELAAVKTV-LDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAGMHIALMALIGEGDEVITPSMTWVSTLNMGANPVMVD-----VDRDTLMVTPEHIEAAITP--------QTKAIIPVH---AGAPADLDAIYAL---GERYGIPVIEDAAHATGTSYK--------ARGTAIFSFHAIKNITC-GGIVVTDNPQFADKLRSLKLAPGYKYNLPDLNAAIALAQLQKLDALNARRAAIAAQYHQAMADLPFQPLSLPSWEHIIRVDEARCGITRDALMASLKTKGIDTEWNSERICSLPLFPDMTESDFDRVITALHQIAGQGS 387
68 -19.8004piw_A mol:protein length:396 TDP-4-keto-6-deoxy-D-glucose transaminase family protein  ali model follow..  17  9VPRGSHMIPFNAPPVV---GTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLIQPGDEVIMPSYTFVSTANAGAKIVFVD-----VRPDTMNIDETLIEAAITD--------KTRVIVPVH---AGVACEMDTIMAL---AKKHNLFVVEDAAQGVMSTYK-GRALGTIGH-IGCFSFHETKNYTA-GGATLINDKALIERAEIIREKIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIP-MFYIKLRDIDDRSALINFLKEAEIYTTKESERLLRLPLFYNLSPVNQRTVIATLLNYFS... 390
69 -19.8003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  36.........IASENYTSPGSQLTNKYAEGYPGKRYYGGCEYVDVVEDRAKELFGADYAVQPHSGSQANFAVYTALLQPGDTVLGAQGGHLTHGSPVNFSGKLYNIVPYGIDESGKIDYDEMAKLAKE-----HKPKMIIGGFS------AYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAA---VYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGDEELYKKLNSAVFPSAQLMHVIAGKAVALKEEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKFVTSGIRIVTRRGFKEAEVKELAGWMCDVLDN.. 395
70 -19.8001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  19  29.........IASENFVSRGSVLTNKYAEGYPGRRYYGGCEYVDIVEERAKQLFGAEHAVQPHSGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQ-FVAYGVDPETHVIDYDDVREKARL-----HRPKLIVAAAS------AYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAA---LHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKA--DNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKFVTSGIRIVTTRGFGLEEMDEIAAIIGLVLKN.. 386
71 -19.7004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  21  28.........IASENITSLATDFMHRYAEGLPGKRLYQGCKYIDEVEELSKELFKAEHAVQPTSGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRG-VINHPFDPEEMNIDADAMVKKILE-----EKPKLILFGGS------LFPFPHPVADAYEAAQEVGAKIAYDGAHVL-GLIAGKQFQDPLREGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSH--VSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHTESHQVIIDIEDIEFSASELAKMYEEANIILNKDNPSGIRLCTRLGMKEKEMEEIAEFMKRIAID.. 392
72 -19.7003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  15  102LSTGLDIIGLAGEWLT----------STANTNMFTYEIAPVFVLMEQITREIVGWSSGIFSPGGAISNMYSIMAARYK--VLFTSEQSHYSIKKAGAALGFGTDNVILIKNERGKIIPADFEAKILEAKQK--YVPFYVNATAGTTVYGAF---DPIQEIADICEKYNLWLHVDAA--WGGGLLMSRKHRHKLNGINSVTWNPHKMMGVLLSAILVKEKGILQGCNQMHAQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNRE-MVFNGEPEHTNVCFWYIPQSLRAPKIKALMMESGTTMVGYKANFFRMISNPAATQSDIDFLIEEIERLGQDL. 505
73 -19.7006blg_A mol:protein length:379 dTDP-4-amino-4,6-dideoxygalactose transaminase  ali model follow..  17  1...SNAMIPFNAPPVV---GTELDYMQSAMNSGKLCGDGGFTRRCQQWMEQRFGTAKALLTPSCTASLEMAALLLIQPGDEVIMPSYTFVSTANAGAKIVFVD-----IRRDTMNIDETLIEAAITD--------KTRAIVPVH---AGVACEMDTIMAI---ADKYNLFVVEDAAQGVMSTYK-GRALGTIGH-IGCFSFHETKNYTA-GGATLINDRTLVERAEIIREKIGSSYLMSDLQAAYLWAQLEAAERINQQRLALWQNYYDALLPLARAGRIELPTVP-MFYIKLRDIEDRSRLIAWLKEAEIYTTQESERLVRLPLFYNLSVVNQRTVINSLLSYFS... 379
74 -19.7006eem_A mol:protein length:512 Tyrosine/dopa decarboxylase  ali model follow..  14  102...........SGSIAGFLGEMLSTGFNVVGF--NWMSSPAATELESIVGQMLTSSDGSSGGGGVLQGTTCEAILCTLTAAVYASDQTHCALQKAAQIAGINPKNVRAIKTSKAGLSPNSLQSAILADIES--LVPLFLCATVGTTSSTAV---DPIGPLCAVAKLYGIWVHIDAA--YAGSACICPEFRHFIDGVDSFSLNAHKWFFTTCCCLWVKDSDSLVKALSTSPALSRRFRSMKLWLVLRSYGVANLRTFLRSHVKMAKHFQGLIGMDNRFEIVVPRTFAMVCFRLKPTAIFKVKLLESVNASGKIYMTHGVYMIRFVGATLTEERHVTGAWKVVQEHTDAI. 509
75 -19.5003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  16  44.......FSHGDVDAHEPTPGAFDSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAARDGLIITPGTQGALLAVAATVARGDKVAIVQPDYFANRKFEGEMVPVQLDYVSADETRAGLDLTGLEEAFK------AGARVFLFSNPNNPA-GVVYSAEEIGQIAALAARYGATVIAD--QLYSRLRYAGASYTHLRAEAAVDA-GPSKTESLSGYRLAFGSRAIIARMEKLQAIV--SLRAAGYSQAVLRGWFDE--DRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQGTEFSPHTADSVRL--NFSQDHEAAVAAARRIVTLVERYR 406

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.