current user: public

If you have questions about the server, please let us know.

Query: 2ig3_A mol:protein length:127 Group III truncated haemoglobin, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYKYGGHLast
1 -74.9002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model  100  1MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYKYGGH 127
2 -48.2004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  15  24PYEILGGEAGALAIANRFYDIMATDEYAKPLYDM----HPLPLDRIRQVFFEFLSGWLGGPDLFVAKHLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNLLREGLKQSFGQLASHMINQ....... 144
3 -48.2001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  11  5FYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPED------DLAGAEERLRMFLEQYWGGPRTYSEQRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSP.. 127
4 -46.3001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  14  2LFEQLGGQAAVQAVTAQFYANIQADATVATFFNGI------DMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAALVEQTVAVAETVRGDVVT........ 115
5 -46.0001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  20  15IYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGT------NMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSTITEILGVIAPLAVDVTSG....... 129
6 -46.0002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  20  15IYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGT------NMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSTITEILGVIAPLAVDVTSG....... 129
7 -46.0002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  16  8LYEAIGGDATVRALTRRFYELMDTLPEAARCRA----IHPADLSGSEAKFYDYLTGYLGGPPVYVEKHLRRRHFVAPIGPAERDEWLLCFRRAMDETENAKLREIIWAPVERLAFHMQNQEADNP.. 133
8 -45.6005v3t_A mol:protein length:132 Globin  ali model follow..  22  8PFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-------DLTETARKQKQFLTQYLGGPNLYTEEHLRARHLPFEITPKRAEAWLSCMEQAMDDTVHGHIREFVFERLALTAQHMVNT....... 125
9 -45.4003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  13  7IYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNT------DMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDVINEAAKVIEHTRKDMLGK....... 121
10 -45.2002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  15  3FYEAVGGEETFTRLARRFYEGVAADPVLRPMYPE------EDLGPAEERLRLFLMQYWGGPRTYSERRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPHLEQQLWEYLVYAAYAMVNV....... 121
11 -44.7005d1v_A mol:protein length:127 Globin  ali model follow..  16  6IYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-------DLEPGKEHQRLFLMQYFGGPRTYSERRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPPARSVMENYFRHAAQAMMNR....... 123
12 -44.2004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  15  10LYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANV------DMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLGMNHHHFDLVAAHLDSTLQELGVAQLKAEAMAIVASARPLIFGTGEAGAAN 135
13 -43.8006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  17  3LHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGV------DMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLGLNLTHFDKVAGHFVDSLKEMGVGELIDEAAGVLIGVRPLFDPE....... 121
14 -43.7001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  23  10...EAIGEELLSQLVDTFYERVASHPLLKPIFPS-------DLTETARKQKQFLTQYLGGPEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVLEGEIREFLFGRLELTARHMVNQTEAEDR. 130
15 -43.0002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  22  6LYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-------DLTETAHKQKQFLTQYLGGPPLYTAEMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSPAREQFYHRLVLTAHHMVNT....... 123
16 -42.8004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  15  36FYEAVGGEETFTRLARRFFEGVAADPVLRPMFPE------EDLGPAEERLRLFLMQYWGGPETYSERRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPHLEQQLWEYLVYAAYAMVNV....... 154
17 -42.2001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  14  4LYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADV------DMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELGLNGEHFDAVAEDLLATLKEMGVPELIAEVAAVAGAPA--HKRDVLNQ... 124
18 -42.0002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  12  3LYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNT------DMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLGLTDVHFDAIAENLVLTLQELNVSQLIDEVVTIVGSVQHR........... 117
19 -41.4001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  14  45LFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNT------DMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLHLSDVHFQAVARHLSDTLTELGVPP---EDITDAMAVVASTRTEVLNMPQQ 164
20 -40.8004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  14  29...DKLGLQTFINLSTNFYTRVYDDEEEWFQSI----FSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKLIGRHRPFPVTHQAAERWLEHMQNALDDSVDQDSKIKMMKFFRHTAFFLVAG....... 147
21 -39.0004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  16  53KVYLAAGEELLRKLVEVHHENLMKSKIHYLFPTS-----HEQLRSLVKRSADFVVEMCGGPPYYTLTRMRARHFSVTIDEKAREIWLACYKHALKDVFPLSVLEEFWQWIESFSIRMINR....... 172
22 -13.3001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  20...........TGFFDDFYRHFLASPQIRAKFAT------TDMTAQKHLLRAGIMNLVMYARGMSDSKLRASRAALDIRPELYDLWLDALLMAVAEHCDAETRDAWRDVMGRGIAVIKSY....... 131
23 -12.6002zfo_D mol:protein length:145 Extracellular giant hemoglobin major globin subunit B1  ali model follow..  18VFNAAMAGSSESAIGVAIFDVFTSSGVSPSMFPGGGDSSSAEFLAQVSRVISGADIAINSLTNRA-HLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL...... 145
24 -12.6002d2m_D mol:protein length:145 Giant hemoglobin, B1(d) globin chain  ali model follow..  18VFNAAMAGSSESAVGVAIFDAFASSGVSPSMFPGGGDSNNPEFLAQVSRVVSGADIAINSLTNRA-HLNAQHRAISGVTGAAVTHLSQAISSVVAQVLPSAHIDAWEYCMAYIAAGIGAGL...... 145
25 -11.4005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  10  34.......APHFPRLAEEFYDRILGHEGARTALVG----GESQVGHLKVTMIAWLDELLGGPEAYWDRRYRRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHGDPPELERVRNALGK......... 144
26 -11.4001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  12  59.......QENIVNIVDAFYKNLDHESSLMDIIND-----HSSVDRLKQTLKRHIQEMFAGVDEFIEKRNRSIHLRIGLLPKWYMGAFQELLLSMIDIYEASIQQELLKAIKATTKILNLEQ...... 173
27 -11.3001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  11  19.......KANIPQYSVVFYTSILEAPAAKDLFSFLANGVDPTNPKLTGHAEKLFALVRDSAGQLKAAALGSVHAQKAVTDPQFVALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA....... 143
28 -11.3002w31_A mol:protein length:162 GLOBIN  ali model follow..  29.......ETNKERLADQFYDYLLGIPETAEFLKE-----DLVLQKLKQTHQDWFVSLFAGSNRYIHNLQKHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPEERRQRREAVEKILDINL...... 143
29 -11.2004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  74.......TTHQSELPGYFYEQMLQDEQAMLFLTH-----EQVKSRLHGTLRQWIVSVFSMSDD-QQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPPEHKLFGQRLISETVDLAM...... 192
30 -11.1004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  14  32.......VAHAHYLSIEFYRIVRIDPHAEEFLSN-----EQVERQLKSAMERWIINVLSAQVDDVERLIQIQHARIGIPVEIVEMGFRVLKKILYPVIFSSDAAEKLQVYHFSINSIDIAM...... 148
31 -11.1004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  32.......TANKAALADYFYESMLADPNAAFFLSD-----QLVKTKLHASMQDWLESVYAAAPT-FQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASLSAAQAAATCR............. 140
32 -10.9002d2m_C mol:protein length:147 Giant hemoglobin, B2(c) globin chain  ali model follow..  12  25.......SDRRVALAQAVFASLSRDAAAQGLFSGVSADDSADFRAHCVRVVNGLDVAINMLNDPA-HLSAQHQARAGVAAAHFDVMAEAFAEVMPQVSSCFSSDSWNRCFARIANGISAGL...... 147
33 -10.8003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  17.......IDKMDEAGLLFYRRLFDEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDI---------RELARRHVKYGVKAEHYHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIEE....... 132
34 -10.6004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  14  27.......VAHAHYLSIEFYRIVRIDPHAEEFLSN-----EQVERQLKSAMERWIINVLSAQVDDVERLIQIQHARIGIPVEIVEMGFRVLKKILYPVIFSSDAAEKLQVYHFSINSIDIAM...... 143
35 -10.5001yhu_C mol:protein length:148 hemoglobin B1a chain  ali model follow..  12  19VWSAAAAAASRVSAGEEVFAALKMVPAAKNLFTRVADINSPEFQGHVVRVMGGLDILINALDDIP-HLAGQHAVRDGVTGAGFQLMATVLMESLPQVVEGFNPDAWASCLAGIAAAISSAL...... 148
36 -10.5003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  14  18.......EPNKNEIGLLFYANLFKEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNL---------QDLGRRHKQYGVVDSHYDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMTAE....... 133
37 -10.5001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  12  18.......KEHGVTITTTFYKNLFAHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNI---------KKIAVKHCQAGVAAAHYQELLGAIKEVLGDAATDDILDAWGKAYGVIADVFIQV....... 136
38 -10.5002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  12  50.......EDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEKLAAVRKRFSRWILDTSNRS.................................................................. 104
39 -10.3003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  14  26.......KKNSAELGLKFFLKIFEAPSAKNLFSYLKDSPIPKLKPHAMTVFVMTCESAVQLRKAGKKRLGAIHFKNGVVNEHFEALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAIKSEMKPSST. 162
40 -10.3001x9f_C mol:protein length:153 Globin III, extracellular  ali model follow..  10  22LWRDTESSKIKIGFGRLLLTKLKDIPEVNDLFKRVDIEEGPKFSAHALRILNGLDLAINLLDDPP----HQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLNA.... 153
41 -10.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  16  19.......NANIPKHTHRFFILVLEAPAAKDLFSFLKGTSEVELQAHAGKVFKLVYEAAIQLEVTG-KNLGSVHVSKGVADAHFPAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKEMDDAA.. 153
42 -10.2002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  21.......AENRAAFSRDLFSELNIQGSSRALFSGVGVDNSAAFTAHCLRVTGALNRLISQLDQQA-AHLAGQHASRNLDASNFAAMGQAVMSVVPTHLDCFNQHAWGECYERIASGIS......... 139
43 -10.2001x9f_A mol:protein length:151 Globin IV, extracellular  ali model follow..  13  22VWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDESGEFKSHLVRVANGLKLLINLLDDTLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDL...... 150
44 -10.1003wct_D mol:protein length:149 B1 globin chain of giant V2 hemoglobin  ali model follow..  10  19IYNAGIGAKSRWTMGNEIFSSLKLKPESEVLFNNVNVASSGAFHAHTVRVLSGLDMGINYLNDAG-HLAAQHVARTGLKAVYFDAMGKVLMTVLPSLIDNFNPDAWRNCLLPLKNAIAKGL...... 148
45 -10.1002qfn_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  15  11.......RGDLRTYAQDIFLAFNKYPDERRYFKNYVGKSDQEFGDHTEKVFNLMMEVADRATDSV-NTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 138
46 -10.0002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  14  17.......QKNGEDLTNEFYKIMNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNI---------DKVAITHVNLGVKEEHYPIVGACLLKAIKNLLDEATLKAWEVAYGKIAKFYIDI....... 133
47 -10.0004jac_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  15  11.......RGDLRTYAQDIFLAFNKYPDERRYFKNYVGKSDQEFGDHSEKVFNLMMEVADRATDCV-NTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 138
48 -10.0005v5r_B mol:protein length:137 Dehaloperoxidase A  ali model follow..  15  10.......RGDLRTYAQDIFLAFNKYPDERRYFKNYVGKSDQEFGDHTEKVFNLMMEVADRATDCV-NTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 137
49 -9.9804hsw_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  15  10.......RGDLRTYAQDIFLAFNKYPDERRYFKNYVGKSDQEFGDHTEKVFNLMMEVADRATDCV-NTLVQMKQHSSLTTGNFEKFFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 137
50 -9.9203mym_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  15  10.......RGDLRTYAQDIFLAFNKYPDERRYFKNYVGKSDQEFGDHTEKVFNLMMEVADRATDCV-NTLVQEKQHSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 137
51 -9.8803zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  13  25.......KKNSAELGLKLFIKIFEAPTTKKMFSFLRDSPIPKLKPHAMSVFVMCCESAVQLRKTGKKRLGASHSKYGVVDEHFEALLETIKEAVPEMWSPEMKVAWGQAYDHLVAAIKAEMNLSN.. 160
52 -9.8304kmw_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  15  10.......RGDLRTYAQDIFLAFNKYPDERRNFKNYVGKSDQEFGDHTEKVFNLMMEVADRATDCV-NTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 137
53 -9.8004u8u_A mol:protein length:150 Globin a chain  ali model follow..  11  26.......TDRKVAIAGAVFKDLHHYPSAKGLFERVKVADSGEYHSHLVRVANGLDLLINLFQDTQ-HLAEQHILRKGVTQQFFKGIGESFARVFPQVSSCFNLEAWNRCFHTLADRISRDL...... 148
54 -9.7904u8u_C mol:protein length:151 Globin c Chain  ali model follow..  13  20LWGDTESSKVKIAFGRLILTKLKEIPEVKELFNKVDIDEGGPFSAHCLRILNALDMSINLMDDPE-HLADQHHDRPGVKKAHFKKIAEILHTGLQQVLDDYNALSWKSCFKGILGKIASKL...... 149
55 -9.7503ixf_A mol:protein length:137 Dehaloperoxidase B  ali model follow..  15  10.......RGDLRTYAQDIFLAFNKYPDEKRNFKNYVGKSDQEFGDHTEKVFNLMMEVADRATDCV-STLVQMKQHSGLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 137
56 -9.6303k3u_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  15  10.......RGDLRTYAQDIFLAFNKYPDERRYFKNYVGKSDQEFGDHTEKWFNLMMEVADRATDCV-NTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 137
57 -9.6303oj1_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  14  10.......RGDLRTYAQDIFLAFNKYPDERRYFKNYVGKSDQEFGDDTEKVFNLMMEVADRATDCV-NTLVQMKQHSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK.... 137
58 -9.5601yhu_D mol:protein length:149 hemoglobin B2 chain  ali model follow..  13  19VWSAQFTGRRIAIAQAVFKDLFANVPDAVGLFGAVKGDNSNEFKAHCIRVVNGLDSSIGLLSDPA-HLATQHKARSGVTKGGFSAIAQSFLRVMPQVASCFNPDAWSRCFNRITTGMTEPLPA.... 149
59 -9.5401oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  15  17.......SRSPLEHGTVLFARLFAEPDLLPLFQYNGRQSSPEFLDHIRKVMLVIDAAVTNVEDLS-ASLGRKHRAVGVKLSSFESLLYMLEKSLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE... 151
60 -9.5204mpm_A mol:protein length:151 Neuroglobin  ali model follow..  14  17.......SRSPLEHGTVLFARLFAEPDLLPLFQYNCRQSSPEFLDHIRKVMLVIDAAVTNVEDLS-ASLGRKHRAVGVKLSSFESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE... 151
61 -9.4303qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  13  26.......KKNSAELGLQFFLKIFEAPSAKNLFSYLKDSPVPKLKPHATTVFVMTCESAVQLRKAGKKRIGAIHFKTGVVNEHFEALLETIKEAVPEMWSPEMKNAWGVAYDQLVAAIKFEMKPSST. 162
62 -9.4001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  17  17....IAGADNGAGVGKECLSKFISHPEMAAVFG-FSGASDPGVAELGAKVLAQIGVAVSHLGDEG-KAVGVRHKNKHIKAEYFESLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGL...... 145
63 -9.4003wct_C mol:protein length:150 B2 globin chain of giant V2 hemoglobin  ali model follow..  12  26.......TGRRLAIAQAVFKDLAHVPDAVGLFDRVHGTDSSEFKAHCIRVVNGLDSAIGLLSDPS-HLATQHQERAGVTKGGFSAIAQSFLRVMPQVASCFNPDAWSRCFNRITNGMTEGLAE.... 150
64 -9.2901jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  17  17....IAGSDNGAGVGKECFTKFLSHHDMAAVFG-FSGASDPGVADLGAKVLAQIGVAVSHLGDEG-KAVGVRHKGYGIKAEYFESLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGL...... 145
65 -9.2702vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  13  20.......SRSPLEHGTVLFARLFAEPSLLPLFQYNGRQSSPEFLDHIRKVMLVIDAAVTNVEDLS-TSLGRKHRAVGVRLSSFESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE... 154
66 -9.2301la6_B mol:protein length:146 Hemoglobin beta-1/2 chain  ali model follow..  8...........RSIISDIFSHMDYDPWTQRYFSGFGNLYNAEVAAHGIKVLHGLDRGMKNMDNIADDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGK.... 143
67 -9.1003hrw_B mol:protein length:146 Hemoglobin subunit beta-1  ali model follow..  13  8...........KAAVSCLWGKVNSDPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHL-ELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHK... 144
68 -9.1002b7h_B mol:protein length:146 hemoglobin beta chain  ali model follow..  18  8...........KSLVSGLWAKVNVDPWTQRFFDSFGDLSTPDVKAHGKKVLNSFSDGLKNLDNLKGKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHK... 144
69 -9.0801cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  11  21...........KQITAKALERVVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSN... 139
70 -9.0201eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  21..............VGILYAVFKADPSIMAKFTQFAGKDLESFETHANRIVGFFSKIIGELPNIEANTFVASHKPRGVTHDQLNNFRAGFVSYMKATDFAGAEAAWGATLDTFFGMIFSKM...... 136
71 -9.0101y45_B mol:protein length:146 Hemoglobin beta chain  ali model follow..  13  8...........KSAVTALWGKVNVDAWTQRFFESFGDLSTPDVKAHGKKVLGAFSDGLAHLDNLKGTLSELHCDKLHVDPENFRVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY...... 145

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.