current user: public

If you have questions about the server, please let us know.

Query: 2ijl_A mol:protein length:135 Molybdenum-binding transcriptional repressor, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GHMSEKRLPLKPVLRIDFPPGERLGHGKVELMQLIAETGSISAAGRAMDMSYRRAWLLVDALNHMFRQPVICSQRGGKQGGGAALTVFGAELLERYRGMEERMNEALREDIDWLEANRNPQDALNRDREPPTLGSLast
1 -69.2002ijl_A mol:protein length:135 Molybdenum-binding transcriptional repressor  ali model  100  1GHMSEKRLPLKPVLRIDFPPGERLGHGKVELMQLIAETGSISAAGRAMDMSYRRAWLLVDALNHMFRQPVICSQRGGKQGGGAALTVFGAELLERYRGMEERMNEALREDIDWLEANRNPQDALNRDREPPTLGS 135
2 -52.9001b9m_A mol:protein length:265 PROTEIN (MODE)  ali model follow..  23  2.....SHMQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLNSLAAISRFSLQTSA.. 130
3 -17.4003fxq_A mol:protein length:305 LysR type regulator of tsaMBCD  ali model follow..  21  1......................MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRT-----KRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQ....................... 85
4 -16.0003isp_A mol:protein length:303 HTH-type transcriptional regulator Rv1985c/MT2039  ali model follow..  19  10...........................QLAALAAVVELGSFDAAAERLHVTPSAVSQRIKSLEQQVGQVLVVREKP------CRATTAGIPLLRLAAQTALLESEALAEM......................... 86
5 -15.7005fo5_A mol:protein length:92 HTH-TYPE TRANSCRIPTIONAL REGULATOR METR  ali model follow..  13  1......................MIEVKHLKTLQALRNCGSLAAAAATLHQTQSALSHQFSDLEQRLGFRLFVRK-----SQPLRFTPQGEILLQLANQVLPQISQALQACNEPQQTRLR................ 92
6 -15.2003fzv_A mol:protein length:306 Probable transcriptional regulator  ali model follow..  17  8...........................QLKYFVTTVECGSVAEASRKLYIAQPSISTAVKGLEESFGVQLFIRHHA-----GVSLTPAGARFYRKAQELLRMAHEFEQNALA....................... 88
7 -15.0005z7h_A mol:protein length:288 LysR family transcriptional regulator  ali model follow..  15  1.......................MKIEDYRLLITLDETKTLRKAAEILYISQPAVTQRLKAIENAFGVDIFIRT-----KKQLITTTEGTMIIEHARDMLKRERLFFDKMQA....................... 84
8 -14.7005y9s_A mol:protein length:304 VV2_1132  ali model follow..  16  14............................LEDFLSLMELGNFSAAAKARFVTQSAFSRRIQALEVWIGVPLFDRT-----SYPITLTEHGQKFVPYAENLLNQVKVTKEDFAQ....................... 92
9 -14.7005z72_A mol:protein length:293 CcpC  ali model follow..  10  5...........................ELHMLVVLAEELNMRKAAERLFVSQPALSQRLQTIEKAWGTKIFLRS-----QKGLTVTPAGEKIIQFANDVTDRQERIRENIDE....................... 84
10 -13.7005y2v_A mol:protein length:324 Rubisco operon transcriptional regulator  ali model follow..  18  9...........................QLKVFEATARHGSFTRAAEELYITQPTVSSQIKQLSKTVGLPLFEQI-----GKRLYLTEAGQELLVTCQDIFQRLDNFAMKVAD....................... 88
11 -13.7003szp_A mol:protein length:291 Transcriptional regulator, LysR family  ali model follow..  17  6............................LNLFRLVVENGSYTSTSKKTMIPVATITRRIQALEDSLNLRLLNRHA------KLTLTEAGERFYKDCSPLLERLASMTEEITDE...................... 85
12 -13.3003hhg_A mol:protein length:306 Transcriptional regulator, LysR family  ali model follow..  20  8............................LTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTT------QLSLTEEGAQYFRRAQRILQEMAAAETEMLA....................... 86
13 -13.1004x6g_A mol:protein length:316 OxyR  ali model follow..  11  5...........................ELRYIVTLAQEQHFGRAAERCHVSQPTLSVGVKKLEDELGVLIFERSK-----SAVRLTPVGEGIVAQAQKVLEQAQGIRE........................... 80
14 -12.7005xxp_A mol:protein length:101 LysR-type regulatory protein  ali model follow..  20  5...........................QLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSH-----RGIELTAAGHAFLEDARRILELAGRSGDR.......................... 81
15 -12.7001utb_A mol:protein length:315 LYSR-TYPE REGULATORY PROTEIN  ali model follow..  13  14.......................IDLNLLVVFNQLLLDRSVSTAGEKLGLTQPAVSNSLKRLRTALNDDLFLRT-----SKGMEPTPYALHLAEPVIYALNTLQTALTT.......................... 94
16 -12.6003mz1_A mol:protein length:300 Putative transcriptional regulator  ali model follow..  19  3............................MRAFLRVVETGNFTRASASLNMPKATVTNLIQGLEAHLRTKLLNRTT------RVLVTPDGALYYERAARLLSDLDEL............................. 75
17 -12.4002esn_A mol:protein length:310 probable transcriptional regulator  ali model follow..  13  10.......................LDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQ-----GNRMQPTQRAEHLAAAVAAALRALGEGLEE.......................... 90
18 -12.2004pzj_A mol:protein length:70 Transcriptional regulator, LysR family  ali model follow..  16  5...........................RVETFLTVCRTMNYTRAAEELNITQPAVSQHIAHLERDYGVPLFAYR-----NKKLQLTDAGALLRDALST..................................... 70
19 -12.2003m1e_A mol:protein length:94 HTH-type transcriptional regulator benM  ali model follow..  5...........................HLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGS------PVKTTPEGHFFYQYAIKLLSNVDQMVSMT......................... 82
20 -12.0001ixc_A mol:protein length:294 LysR-type regulatory protein  ali model follow..  20  5...........................QLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSH-----RGIELTAAGHAFLEDARRILELAGRSGDRS......................... 82
21 -11.6004hw0_A mol:protein length:104 DNA-binding protein Sso10a-2  ali model follow..  10  15............................FDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKV----ALNIKTENDR----EITEKGKLLRTHIEEFIKIRENL............................. 88
22 -11.4002h98_A mol:protein length:313 HTH-type transcriptional regulator catM  ali model follow..  12  5...........................HLRYFVTVVEEQSISKAAEKLCIAQPPLSRQIQKLEEELGIQLFERGF------PAKVTEAGMFFYQHAVQILTHTAQASSMA......................... 82
23 -11.3002h99_A mol:protein length:312 HTH-type transcriptional regulator benM  ali model follow..  5...........................HLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGIQLLERGS------PVKTTPEGHFFYQYAIKLLSNVDQMVSMT......................... 82
24 -11.3004gwo_A mol:protein length:330 HTH-type transcriptional regulator CysB  ali model follow..  10  9..............................IVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFAR----SGKHLTQVTPAGQEIIRIAREVLSKVDAIKSVAGE....................... 86
25 -11.2005jls_A mol:protein length:155 Adhesin competence repressor  ali model follow..  36.......................LTNTQEHILMLLSQQRTNTDLAKALNISQAAVTKAIKSLVKQ----MLAGTKDTVDA--FELTELAKPIASEHTHHHDETLNVYNRLLQKFSAK.................. 129
26 -11.2001al3_A mol:protein length:324 CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB  ali model follow..  10  9..............................IVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFAR----SGKHLTQVTPAGQEIIRIAREVLSKVDAIKSVAGE....................... 86
27 -11.0005jlu_A mol:protein length:150 Adhesin competence repressor  ali model follow..  39.......................LTNTQEHILMLLSQQRTNTDLAKALNISQAAVTKAIKSLVKQ----MLAGTKDTVDA--FELTELAKPIASEHTHHHDETLNVYNRLLQKFSAK.................. 132
28 -10.7001r7j_A mol:protein length:95 Conserved hypothetical protein Sso10a  ali model follow..  20  11............................QAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDL----IIR-----QEGKQYMLTKKGEELLEDIRKFNEMRKNM............................. 80
29 -10.7002wte_A mol:protein length:244 CSA3  ali model follow..  11  144.......................YSREEMKLLNVLYETKGITELAKMLDKSEKTLINKIAELKKF----ILTQK---GKDRKVELNELGLNVIKLNKSVIESSKSSEELVKENKGKEVN................ 235
30 -10.3005yhx_A mol:protein length:146 Zinc transport transcriptional regulator  ali model follow..  13  36.......................LTSTQEHILMLLAEQITNAKIAEKLKISPAAVTKALKKLQEQ----LIKSSRATNDE--WSLTEKAVPVAKEHATHHEKTLSTYQELGNKFTDE.................. 129
31 -9.8705yi0_B mol:protein length:146 Zinc transport transcriptional regulator  ali model follow..  11  36.......................LTSTQEAILMLLEQISTNAKIAEKLKISPAAVTKALKKLQEQ----LIKSSRATNDE--WSLTEKAVPVAKEHATHHEKTLSTYQELGNKFTDE.................. 129
32 -9.5203f3x_A mol:protein length:144 Transcriptional regulator, marR family, putative  ali model follow..  14  35.......................LSYLDFSILKATSEEPSMVYLANRYFVTQSAITAAVDKLEAK----LVRRIRDSKDR--VEITPKGRQVL---LEANEVLRNLVNEMLSDVENVEELLEGLNKILSRIGSSK 143
33 -9.4202nyx_A mol:protein length:168 Probable transcriptional regulatory protein, Rv1404  ali model follow..  13  43.......................ITIPQFRTLVILSNHGPINLAATLLGVQPSATGRMVDRLVGA----LIDRLPHPTSRRELALTKRGRDVVRQVTEHRRT................................. 122
34 -9.2302obp_A mol:protein length:96 Putative DNA-binding protein  ali model follow..  18  14.......................IDPAIVEVLLVLREAGSLPKIAKRAQLPMSVLRRVLTQLQAA----LADVSVEADGRGHASLTQEGAALAAQ........................................ 90
35 -9.1503bj6_A mol:protein length:152 Transcriptional regulator, MarR family  ali model follow..  14  38.......................VTVGQRAILEGLSLTPGATAPGAALQMKRQYISRILQEVQRA----LIERRTNPEHARSHRLTPRGEAIITAIRADEMAKLALFSEGFSS...................... 128
36 -9.0402qvo_A mol:protein length:95 Uncharacterized protein AF_1382  ali model follow..  11  10.......................FKEKALEILMTIYYESYIQYIASKVNSPHSYVWLIIKKFEEA----MVECELEGRT---IRLTDKGQKIAQQIKSIIDIMENDT............................ 95

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24