current user: public

If you have questions about the server, please let us know.

Query: 2kvq_G mol:protein length:63 Transcription antitermination protein nusG, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60
# Score Template Links and tools%idFirst GAMGRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKALast
1 -37.7002kvq_G mol:protein length:63 Transcription antitermination protein nusG  ali model  100  1GAMGRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA 63
2 -35.4006duq_M mol:protein length:60 Transcription termination/antitermination protein NusG  ali model follow..  95  1...SNAKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA 60
3 -35.3002mi6_A mol:protein length:62 Transcription termination/antitermination protein NusG  ali model follow..  50  2..RPVVEVDYEVGESVTVMDGPFATLPATISEVNAEQQKLKVLVSIFGRETPVELTFGQVSKI 62
4 -34.0001nz9_A mol:protein length:58 TRANSCRIPTION ANTITERMINATION PROTEIN NUSG  ali model follow..  59  2......QVAFREGDQVRVVSGPFADFTGTVTEINPERGKVKVMVTIFGRETPVELDFSQVVKA 58
5 -33.6005ms0_F mol:protein length:183 Transcription termination/antitermination protein NusG  ali model follow..  95  121GDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA 183
6 -33.0002lq8_A mol:protein length:177 Transcription antitermination protein nusG  ali model follow..  47  114KKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKI 176
7 -30.0002xhc_A mol:protein length:352 TRANSCRIPTION ANTITERMINATION PROTEIN NUSG  ali model follow..  47  290KKPVKVELGFKVGDMVKIISGPFEDFAGVIKEIDPERQELKVNVTIFGRETPVVLHVSEVEKI 352
8 -29.5001m1g_A mol:protein length:248 Transcription antitermination protein nusG  ali model follow..  59  188..VKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI 248
9 -29.1002lcl_A mol:protein length:66 Transcriptional activator rfaH  ali model follow..  16  6.KDIVDPATPYPGDKVIITEGAFEGFQAIFTEPD-GEARSMLLLNLINKEIKHSVKNTEFRKL 66
10 -25.2002oug_A mol:protein length:162 Transcriptional activator rfaH  ali model follow..  16  102.KDIVDPATPYPGDKVIITEGAFEGFQAIFTEPD-GEARSMLLLNLINKEIKHSVKNTEFRKL 162
11 -23.9004zn1_A mol:protein length:147 Transcription elongation factor Spt5  ali model follow..  20  81.TPKKIIENIEKGDVVEIIAGPFKGERAKVIRVDKHKEEVTLELENAAVPIPITLPVEGVKIV 142
12 -21.3003qqc_D mol:protein length:163 Transcription antitermination protein nusG  ali model follow..  24  84.EEKPAVSGLEPGDLVEVIAGPFKGQKAKVVKIDESKDEVVVQFIDAIVPIPVTIKGDYVRLI 145
13 -17.7002e6z_A mol:protein length:59 Transcription elongation factor SPT5  ali model follow..  21  8.........FQPGDNVEVCEGELINLQGKILSVDGN--KITIMPKHEDLKDMLEFPAQELRK. 58
14 -13.7002e70_A mol:protein length:71 Transcription elongation factor SPT5  ali model follow..  20  20...........IGQTVRISQGPYKGYIGVVKDATEST----ARVELHSTCQTISVDRQRLTTV 67
15 -13.3005xog_W mol:protein length:83 Spt4/5 complex component  ali model follow..  14  20...........LNKTVKIRQGGYKGKIGIVKEANGDR----FRVELHNPNKTIPIPCSFLLIE 67
16 -13.0004ytl_A mol:protein length:99 Transcription elongation factor SPT5  ali model follow..  26  1.........FQPGDRIEVLNGEQRGSKGIVTRTTKD----IATIKLNGFTTPLEFPISTLRKI 50
17 -12.1001s72_T mol:protein length:120 50S ribosomal protein L24P  ali model follow..  33  40......NVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVLEKTDGEEVPRPLDTSNV... 97
18 -11.6005xon_W mol:protein length:612 Protein that forms a complex with Spt4p  ali model follow..  14  549...........LNKTVKIRQGGYKGKIGIVKEANGDR----FRVELHNPNKTIPIPCSFLLIE 596
19 -11.4005t5h_Z mol:protein length:113 60S ribosomal protein L26  ali model follow..  20  38......AMPVRKDDEVRVKRGAYKGREGKVTACYRLRWVIHIREKANGTTVPVGVHPSNV... 95
20 -11.3005t2a_X mol:protein length:143 uL24  ali model follow..  20  44......AMPVRKDDEVIVKRGAFKGREGKVTACYRLKWVIHI--KANGSTVAVGIHPSNV... 101
21 -11.2002ww9_L mol:protein length:127 60S RIBOSOMAL PROTEIN L26-A  ali model follow..  20  47......ALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAVQV--KVNGASVPINLHPSKL... 104
22 -11.2003j79_Z mol:protein length:126 60S ribosomal protein uL24  ali model follow..  16  46......SLPVRKDDEVLICRGHNHGREGKVVKINRKRYKIYV--KVNGESTFIGIHPSNV... 103
23 -11.2005xy3_Y mol:protein length:138 Ribosomal protein L24, putative  ali model follow..  22  47......RLPIRRDDEVMIFSGRMQNRTGKVTAVKLSEMRIYVTEKINGQAVSFPVHPSNV... 104
24 -11.1003jcs_W mol:protein length:143 ribosomal protein L24  ali model follow..  20  44......AMPVRKDDEVIVKRGTFKGREGKVTACYRLKWVILI--KANGSTVAVGIHPSNV... 101
25 -10.9003j6b_Q mol:protein length:297 54S ribosomal protein L40, mitochondrial  ali model follow..  24  63.........FIPGDRVVVMSGASKGNIAVIKSFDKRTNSFIL..................... 95
26 -10.7005xxb_X mol:protein length:141 Ribosomal protein uL24  ali model follow..  20  46......SLPIRKDDEVMVVRGHHHDREGKVTKVYRKKWVIHI--KANGETVTIGIHPSKV... 103
27 -10.6004ytk_A mol:protein length:130 Transcription elongation factor SPT5  ali model follow..  17  1.........LEEGSYVRIKRGIYKGDLAMVDQISENNLEVMLKI................... 35
28 -10.6005v7q_U mol:protein length:105 50S ribosomal protein L24  ali model follow..  24  3.........VHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLV..................... 35
29 -10.5005o60_V mol:protein length:105 50S ribosomal protein L24  ali model follow..  21  3.........VHKGDTVLVISGKDKGAKGKVLVAYPDRNKVLV..................... 35
30 -10.5002do3_A mol:protein length:69 Transcription elongation factor SPT5  ali model follow..  30  18.........FKMGDHVKVIAGRFEGDTGLIVRVEEN------FVILFSDLTMHELKV...... 59
31 -10.3004v4i_S mol:protein length:110 50S ribosomal protein L24  ali model follow..  31  2....RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIV..................... 39
32 -10.3002ckk_A mol:protein length:127 KIN17  ali model follow..  13  72..........APGKRILVLNGGYRGNEGTLESINEKTFSATIVIEPLKGRRVEGIQYEDISKL 126
33 -10.3004wce_R mol:protein length:105 50S ribosomal protein L24  ali model follow..  27  3.........IKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVV..................... 35
34 -10.2003j3v_U mol:protein length:103 50S ribosomal protein L24  ali model follow..  24  3.........VKKGDKVMVISGKDKGKQGTILAAFPKKDRVLV..................... 35
35 -10.1001nkw_S mol:protein length:115 50S ribosomal protein L24  ali model follow..  25  13......KLHFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVV..................... 48
36 -9.7903j7z_U mol:protein length:104 50S ribosomal protein L24  ali model follow..  16  2......AAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVE..................... 37
37 -9.6304ce4_Y mol:protein length:216 MRPL24  ali model follow..  24  56.........LFCGDKVEILEGKDAGKQGKVVQVIRQRNWVVV..................... 88
38 -9.4403j7y_V mol:protein length:216 uL24  ali model follow..  24  56.........LFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVV..................... 88
39 -9.3005oik_Z mol:protein length:1087 Transcription elongation factor SPT5  ali model follow..  23  420.........FQPGDNVEVCEGELINLQGKILSVDGNK--ITIMPKHEDLKDMLEFPAQELRKY 471
40 -9.2505mmi_V mol:protein length:192 plastid ribosomal protein uL24c  ali model follow..  18  70.........VKVGDTVKVISGGEKGKIGEISKIHKHNSTVII..................... 102
41 -9.2105mlc_W mol:protein length:191 50S ribosomal protein L24, chloroplastic  ali model follow..  18  69.........VKVGDTVKVISGGEKGKIGEISKIHKHNSTVII..................... 101
42 -9.1305ohq_A mol:protein length:111 Transcription elongation factor SPT5  ali model follow..  20  60..........TKNNKVKVILGEDREATGVLLSIDGED----GIVRMDLDEQLKILNLRFLGKL 108
43 -9.0502e5p_A mol:protein length:68 PHD finger protein 1  ali model follow..  16  1GSSGSSGPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQ---FEDDSQFLVLWKDISPA 60

FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 6 1 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.