current user: public

If you have questions about the server, please let us know.

Query: 2veb_A mol:protein length:195 PROTOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MSVEKIPGYTYGETENRAPFNLEDLKLLKEAVMFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVESVPNIGYRYLVAFIYPITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGDFLast
1 -84.4002veb_A mol:protein length:195 PROTOGLOBIN  ali model  100  1MSVEKIPGYTYGETENRAPFNLEDLKLLKEAVMFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVESVPNIGYRYLVAFIYPITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGDF 195
2 -60.4005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  16  2.................TGVPETVFEELKRYVGWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALVG-----GESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHG-----------DPPELERVRNALGKVLDLELAVMLHTYRED... 160
3 -58.9002w31_A mol:protein length:162 GLOBIN  ali model follow..  18  1.....................MLTMQEIKAHYRFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLK------EDLVLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHYVNVAMNVV------------RQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASYREEEM. 155
4 -57.1001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  11  19.........GQQKNRIQLTNKHADVKKQLKMVRLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIIN------DHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMI------------DIYEASITNQQELLKAIKATTKILNLEQQLVLE........ 178
5 -49.9004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  11  1.................MKPSPEILALRWKDT-SAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLS------DQLVKTKLHASMQDWLESVYAAAPTEEYVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELL-----------DRDASLSAAQAAATCRYVADVTMTAVEMMSHAYSVSHD. 162
6 -49.9004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  13  1.................MEMYFKRMKDEWTGL-VEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLS------NEQVERQLKSAMERWIINVLSAQVDERLIQIQHTVAEVHARIGIPVEIVEMGFRVL------------KKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFLE.... 157
7 -48.6004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  13  1......................GAMKDEWTGL-VEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLS------NEQVERQLKSAMERWIINVLSAQVDERLIQIQHTVAEVHARIGIPVEIVEMGFRVL------------KKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDS. 155
8 -47.3004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  13  46.....................SPEQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFLT------HEQVKSRLHGTLRQWIVSVFSMSDDDALIAQQKQIGEIHARIKIPIHLVLRGARHL------------RERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRAFSDAYD. 204
9 -19.9001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  11  1...............................VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEAPAAKDLFSANGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQF----VVVKEALLKTIKAAVGDKWSD-------------ELSRAWEVAYDELAAAIKKA....... 143
10 -17.4001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  11  12...............................VSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEAPSASQMFSFLRNSDVPTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHF----------------EVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE.. 166
11 -17.4002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  10  1........................MSAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEAPSARQMFPFLRDSDVPTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHF----------------EVTRFALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE.. 162
12 -17.3003mvc_A mol:protein length:161 Globin protein 6  ali model follow..  12  1...............................LHLTQPQILFVRKTWNHARNQALEPAISIFRNSFFNPEIRQMIMFGTKNEGHERLKKHAQLFTVLMDDLIANLDSSATVAGLREAGEKHVWPTRNQYGC----------FHAHLLDQFATAMIERTLEWGEKKDRTETTQRGWTKIVLFVTEQLKEGFQDEQK. 157
13 -17.1002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  12  11...............................VVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEAPSAKQMFSFLRDSDVPTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHF----------------EVTGFALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPDA.. 165
14 -17.0001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  10  2................................ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEAPAAKDLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQVTDATLKNLGSVHVSKGVADAHF----PVVKEAILKTIKEVVGAKWSE-------------ELNSAWTIAYDELAIVIKKEMDDAA.. 153
15 -16.9004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  12  7...............................MQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMENPETFQIFPWADASKTAKEMRS-HPRFKSHAKSIGKV---KKHEPKLSSLGAMHTKKKVPTELF----------------GKLGGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE........ 154
16 -16.8003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  13  1........................MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEAPSAKNLFSYLKDSPIPPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHF----EVTRFALLETIKEAVPEMWSP-------------EMKNAWGEAYDQLVAAIKSEMKPSS.. 161
17 -16.7003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  14  7...............................IVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEAPTTKKMFSFLRDSPIPPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHF----EVAKYALLETIKEAVPEMWSP-------------EMKVAWGQAYDHLVAAIKAEMNLSN.. 160
18 -16.7001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  16  1................................AFTACEKQTIGKIAQVLAKSPEAYGAECLARLFVHPGSKSYFEYKDYSAAGAKVQVHGGKVIRAVVKAAEH---DDLHSHLETLALTHGKLLVDPQNF----PMLSECIIVTLATHLTEF--------------SPDTHCAVDKLLSAICQELSSRY...... 139
19 -16.6002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  13  3................................HMERPESELIRQSWRVVSRSPLEHGTVLFARLFAEPSLLPLFQYNGRQFSSPEDSLSSPEFLDHIRKVMLV---SSLEEYLTSLGRKHRAVGVRLSSF----STVGESLLYMLEKSLGPDFTP-------------ATRTAWSRLYGAVVQAMSRGWDGE... 154
20 -16.6001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  15  2.................................LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAHPEVRPLFDMGRQESLEQP-KALAMTVLAAAQNIEN----PAILPAVKKIAVKHCQAGVAAAHY----PIVGQELLGAIKEVLGDAA---------TDDILDAWGKAYGVIADVFIQVEADLYAQAVE. 146
21 -16.6001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  12  1.................................MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFQYNGRQFSSPEDSLSSPEFLDHIRKVMLV---SSLEEYLASLGRKHRAVGVKLSSF----STVGESLLYMLEKSLGPAFTP-------------ATRAAWSQLYGAVVQAMSRGWDGE... 151
22 -16.4004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  12  1.................................MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLV---SSLEEYLASLGRKHRAVGVKLSSF----STVGESLLYMLEKCLGPAFTP-------------ATRAAWSQLYGAVVQAMSRGWDGE... 151
23 -16.4001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  10  5.........................QSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHDPTAQRKFPSPAELRTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNY----DLFGKVLMEAIKAELGVGFTK-------------QVHDAWAKTFAIVQGVLITKH...... 157
24 -16.3002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  13  1.................................MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNYPEVKPMF-NMEKQISGEQPKALAMAILMAAKNIEN----ENMRSFVDKVAITHVNLGVKEEHY----PIVGACLLKAIKNLL-----------NPDEATLKAWEVAYGKIAKFYIDIEKKLYDK.... 140
25 -16.2003mkb_A mol:protein length:140 Hemoglobin subunit alpha  ali model follow..  14  1................................AFTGVERSTIGAIAKILASTPEAYGAEALARLFAHPGAKSYFDYADYSAAGAKVQLHGGKVIRAVVSAAEH---DDLHAHLMVLAVTHGK--------------VDPSNFPMLSECILVTLATHLAEFSPATHC------AVDKLLSAISSELSSKY...... 139
26 -16.1002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  10  2.................................LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVADGLTLAVGH---DDLPGALSDLSNLHAKLRVDPVNF----KLLSHCLLSTLAVHLPNDFTP-------------AVHASLDKFLSSVSTVLTSKY...... 140
27 -16.1003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  15  1........................MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEAPSAKNLFSYLKDSPVPPHATTVFVMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVVNEHF----EVTRFALLETIKEAVPEMWSP-------------EMKNAWGVAYDQLVAAIKFEMKPS... 160
28 -15.9001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  12  12................................DLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFADPSAQNKFPSASQLRSSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHY----NLFAKVLMEALQAELGSDFNE-------------KTRDAWAKAFSVVQAVLLVKH...... 157
29 -15.9004bja_A mol:protein length:266 PROTEIN GLB-12  ali model follow..  30...............................LALNKKDRTLLRETWQRLDDPKDIVGLIFLDIVNDEPDLKKVFGVDRAPRAAGHILRFYEFMEQLTSMLGTSENLTGAWQLVRKTGRSHVRQGFLEQNQNQMEKNYFEIVINVFIERLIPFLTGNKKVRFAQNYTTSQITDVWKKFLNTVISQMTDSFELERA. 212
30 -15.8002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  11  1.................................MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNFPSNLEKFPFRDVPLEEAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESY----------------NQLKGVILDVLTAASSLDESQAA---TWAKLVDHVYAIIFKAIDDDGN. 151
31 -15.8001g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  10  2.................................LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGH---DDLPGALSDLSNLHAKLRVDPVNF----KLLSHCLLSTLAVHLPNDFTP-------------AVHASLDKFLSSVSTVLTSKY...... 140
32 -15.8003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  17  1.................................MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDEPKVRPLFKIDIEKQGRKLMDVLNWIVLN-----------DAALDAARELARRHVKYGVKAEHY----PVVGHTLIWTLRKMIGSEWTK-------------QLEQLWTQAYEALAQVMIEE....... 132
33 -15.7001o1o_A mol:protein length:141 Hemoglobin Alpha chain  ali model follow..  10  2.................................LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGKKLADALTNAVAH---DDMPNALSALSDLHAHLRVDPV----NFKLLSHCLLVTLAAHLPAEFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
34 -15.6003dhr_A mol:protein length:142 Hemoglobin subunit alpha-A  ali model follow..  11  1...............................MVLSANDKSNVKAVFAKIGGQAGDLGGEALERLFIYPQTKTYFPHFDLSHGSAQIKGHGKKVAEALVEAANH---DDIAGALSKLSDLHAKLRVDPVN----FKLLGHCFLVVVAVHFPSLLTP-------------EVHASLDKFVLAVGTVLTAKY...... 141
35 -15.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  14  2.................................IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEPTVSVLFQNPISSQSRKLMQVLGILVQG-----------EGLIPTLQDLGRRHKQYGVVDSHY----PLVGDCLLKSIQEYLGQGFTE-------------EAKAAWTKVYGIAAQVMTA........ 132
36 -15.6003cy5_A mol:protein length:141 Hemoglobin subunit alpha-2  ali model follow..  11  2.................................LSAADKSNIQAAWGKVGGHAADYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGAKVANALTKAVGH---DDLPGALSELSDLHAKLRVDPVNF----KLLSHSLLVTLASHLPNDFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
37 -15.5003at5_A mol:protein length:141 AlphaA-globin  ali model follow..  10  2.................................LSPGDKANVKTVWSKVSGHVEDYGAETLERLFRYPSTKTYFPHFDLHHDSAQIRTHGKKVLTAIGEAVSH---DDIASALSKLSDLHAQLRVDPV----NFKLLSHSFLVVLAVHAPSLLTP-------------EVHVSLDKFLVAVSNVLTSKY...... 140
38 -15.5001hds_A mol:protein length:141 HEMOGLOBIN S (DEOXY) (ALPHA CHAIN)  ali model follow..  10  2.................................LSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLFPTTKTYFPHFDLSHGSAQQKAHGQKVANALTKAQGH---NDLPGTLSNLSNLHAKLRVNPV----NFKLLSHSLLVTLASHLPTNFTP-------------AVHANLNKFLANDSTVLTSKY...... 140
39 -15.5001xz7_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  12  2.................................LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVA-HVDDMPNALSALSDLHAHKLAVDPV----NFKLLSHCLLVTLAAHLPAEFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
40 -15.5003dht_A mol:protein length:141 Hemoglobin subunit alpha-1/2  ali model follow..  12  2.................................LSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAFPTTKTYFSHIDVSPGSAQVKAHGKKVADALAKAADH---EDLPGALSTLSDLHAKLRVDPV----NFKFLSHCLLVTLACHHPGDFTP-------------AMHASLDKFLASVSTVLTSKY...... 140
41 -15.3002qmb_A mol:protein length:142 Hemoglobin subunit alpha-A  ali model follow..  12  1...............................MVLSAADKNNVKGIFTKIAGHAEEYGAETLERMFIYPPTKTYFPHFDLSHGSAQIKGHGKKVVAALIEAANH---DDIAGTLSKLSDLHAKLRVDPVNF----KLLGQCFLVVVAIHHPAALTP-------------EVHASLDKFLCAVGTVLTAKY...... 141
42 -15.2001xy0_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  10  2.................................LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLFPTTGTYFPHFDLSHGSAQVKGHGKKVADALTNAVAH---DDMPNALSALSDLHAHLRVDPV----NFKLLSHCLLVTLAAHLPAEFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
43 -15.2003a0g_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  13  2.................................LSAADKNNVKTTWDKIGGHAAEYVAEGLTRMFTFPTTKTYFHHIDVSPGSGDIKAHGKKVADALTTAVGHLDDPTALSTLSDVHAHKLRVDPV------NFKFLNHCLLVTLAAHLGADFTP-------------SIHASLDKFFASVSTVLTSKY...... 140
44 -15.1002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  11  1..............................XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKHPETLTPFKSLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVLIQKMAKLHNNRGIRASDL----------------RTAYDILIHYMEDHNHMVGGAKD---AWEVFVGFICKTLGDYMKELS.. 152
45 -15.1001s0h_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  10  2.................................LSAADKTNVKAAWSKVGGNAGEFGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGH---DDLPGALSNLSDLHAHLRVDPVNF----KLLSHCLLSTLAVHLPNDFTP-------------AVHASLDKFLSSVSTVLTSKY...... 140
46 -15.1003wtg_A mol:protein length:142 Hemoglobin subunit alpha-A  ali model follow..  12  1...............................MVLSAADKTNTKSVFAKIGPHAEEYGAETLERLFTYPQTKTYFPHFDLHHGSAQVKAHGKKVAAALVEAANH---DDISTALSKLSDLHAKLRVDPVNF----KLLGQCFLVVVAIHHPSLLTP-------------EVHASLDKFLCAVANVLTAKY...... 141
47 -15.1001y09_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  12  2.................................LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVA-HVDDMPNALSALSDLHAHKLRVDPVA----FKLLSHCLLVTLAAHLPAEFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
48 -15.1003gdj_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  10  2.................................LSSKDKTNVKTAFGKIGGHAAEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTKAADH---DDLPSALSALSDLHAKLRVDPVN----FKLLSHCLLVTVAAHHPGDFTP-------------SVHASLDKFLANVSTVLTSKY...... 140
49 -15.0001jeb_A mol:protein length:142 HEMOGLOBIN ZETA CHAIN  ali model follow..  17  1...............................XSLTKTERTIIVSMWAKISTQADTIGTETLERLFLHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDGGALSKLSELHAYILRVDPV------NFKLLSHCLLVTLAARFPADFTA-------------EAHAAWDKFLSVVSSVLTEKY...... 141
50 -15.0003fh9_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  11  2.................................LSSTDKSNVKAAWDKVGGNVGEYGAEALERMFLFPTTKTYFPHFDLAHGSSQVKAHGKKVGDALTNAVGH---DDLPGALSALSDLHAYLRVDPV----NFKLLSHCLLVTLASHLPSDFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
51 -15.0002zfb_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  12  2.................................LSGTDKTNVKSIFSKIGGQADDYGAEALERMFVYPQTKTYFPHFDVSPGSAQVKAHGKKVAGGLSEAANH---DDIATSLSKLSDLHAKLRVDPVN----FKLLGQCFLVVVAIHNPSALTP-------------EAHASLDKFLCAVGLVLTAKY...... 140
52 -14.8004h2l_A mol:protein length:141 Alpha-globin  ali model follow..  11  2.................................LSADDKANIKAAWGKIGGHGAEYGAEALERMFCFPTTKTYFPHFDVSHGSAQVKAHGGKVADALATAAGH---DDLPAALSALSDLHAHLRVDPV----NFKLLSHCLLVTLAAHLPSDFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
53 -14.8003d1a_A mol:protein length:142 Hemoglobin subunit alpha-1/2  ali model follow..  10  1...............................MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGEKVAAALTKAVGHLDDPGTLSDLSDLHAHKLRVDPV------NFKLLSHSLLVTLACHLPNDFTP-------------AVHASLDKFLANVSTVLTSKY...... 141
54 -14.7003mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  14  1...............................VHWTQEERDEIVKTFFSANS--SAIGTKALERMFVFPWTNAYFAKXXXFSASIHAAIVVGALQDAVKHE------DDVKAEFVNISKAHAKLHIDPGSF----HLLTDSFIVELAHLKKVAFTP-------------FVFAVWIKFFQVVIDAISSQY...... 135
55 -14.7003a59_A mol:protein length:141 Hemoglobin subunit alpha-A  ali model follow..  14  2.................................LSGTDKTNVKGIFSKISSHAEEYGAETLERMFIYPQTKTYFPHFDLHHGSAQIKAHGKKVANALIEAVNHIDDSGALSKLSDLHAQKLRVDPV------NFKLLGQCFLVVVAIHHPSALTP-------------EVHASLDKFLCAVGAVLTAKY...... 140
56 -14.7001bab_A mol:protein length:143 HEMOGLOBIN THIONVILLE (DEOXY) (ALPHA CHAIN)  ali model follow..  10  1..............................XMELSPADKTNVKAAWGKVGAHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAH---DDMPNALSALSDLAHKLRVDPV----NFKLLSHCLLVTLAAHLPAEFTP-------------AVHASLDKFLASVSTVLTSKY...... 142
57 -14.7003d4x_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  10  2.................................LSAADKSNVKACWGKIGSHAGEYGAEALERTFCFPTTKTYFPHFDLSHGSAQVKAHGQKVADALTQAVAH---DDLPTAMSALSDLHAYLRVDPVN----FKFLSHCLLVTLACHHPAEFTP-------------AVHASLDKFFSAVSTVLTSKY...... 140
58 -14.7001xye_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  10  2.................................LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLFPTTKTAFPHFDLSHGSAQVKGHGKKVADALTNAVAH---DDMPNALSALSDLHAHLRVDPVNF----KLLSHCLLVTLAAHLPAEFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
59 -14.7001fhj_A mol:protein length:141 HEMOGLOBIN (ALPHA CHAIN)  ali model follow..  10  2.................................LSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQFPTTKTYFPHFDLSPGSAQVKAHGKKVADALTTAVAH---DDLPGALSALSDLAYKLRVDPVNF----KLLSHCLLVTLACHHPTEFTP-------------AVHASLDKFFTAVSTVLTSKY...... 140
60 -14.7004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  11  1.......................XVDAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTRPDTKTYFTRLGDVQKGKANSKLRGHAITLTYALNN-DDPSRLKCVVEKFAVNHINRKISGDAF----GAIVEPMKETLKARMGNYYSD-------------DVAGAWAALVGVVQAAL.......... 150
61 -14.6001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  11  1...............................XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEFPDSANFFASVADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMAMLSQFAKEHVGFGVGSAQF----------------ENVRSMFPGFVASVAAPPAGADA---AWTKLFGLIIDALKAAG...... 146
62 -14.6002rao_A mol:protein length:141 Hemoglobin subunit alpha-1/2  ali model follow..  13  2.................................LSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLFPTTKTYFPHFDFTHGSEQIKAHGKKVSEALTKAVGH---DDLPGALSTLSDLHAHLRVDPVNF----KLLSHCLLVTLANHHPSEFTP-------------AVHASLDKFLANVSTVLTSKY...... 140
63 -14.6001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  14  1...............................VKLSEDQEHYIKGVWKDVDH--KQITAKALERVFVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNF----KLLGQTFMVELALHYKKTFRP-------------KEHAAAYKFFRLVAEALSSNY...... 140
64 -14.6005ker_C mol:protein length:141 Alpha-globin  ali model follow..  12  2.................................LSADDKANIKAAWGKIGGHGAEYGAEALERMFCFPTTKTYFPHFDVSPGSAQVKGHGAKVAGALATAASH---DDLPAALSALSDLHAKLRVDPV----NFKLLSHCLLVTLAAHHPAEFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
65 -14.6001iwh_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  10  2.................................LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGH---DDLPGALSNLSDLHAKLRVDPVNF----KLLSHCLLSTLAVHLPNDFTP-------------AVHASLDKFLSSVSTVLTSKY...... 140
66 -14.6001gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  12  1...............................VHWTQEERDEISKTFQGTDM--KTVVTQALDRMFKYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHM------DDVKTLFKDLSKKHADLHVDPGSF----HLLTDCIIVELAYLRKDCFTP-------------HIQGIWDKFFEVVIDAISKQY...... 135
67 -14.6003mjp_A mol:protein length:141 Hemoglobin subunit alpha-A  ali model follow..  12  2.................................LSAADKTNVKGIFAKIAGHAEEYGAEALDRMFTYPQTKTYFPHFDVSHGSAQIKGHGKKVAAALVEAANH---DDIAGTLSKLSDLHQKLRVDPVNF----KLLGQCFLVVVAIHHPAALTP-------------EVHASLDKFLCAVGTVLTAKY...... 140
68 -14.6003hrw_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  12  2.................................LSGEDKSNIKAAWGKIGGHGAEYGAEALERMFAFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGH---DDLPGALSALSDLHAKLRVDPV----NFKLLSHCLLVTLASHHPADFTP-------------AVHASLDKFLASVSTVLTSKY...... 140
69 -14.6001a4f_A mol:protein length:141 HEMOGLOBIN (ALPHA CHAIN)  ali model follow..  12  2.................................LSAADKTNVKGVFSKISGHAEEYGAETLERMFTYPQTKTYFPHFDLQHGSAQIKAHGKKVVAALVEAVNH---DDIAGALSKLSDLHAKLRVDPVN----FKFLGHCFLVVVAIHHPSALTA-------------EVHASLDKFLCAVGTVLTAKY...... 140
70 -14.6001hbr_A mol:protein length:141 PROTEIN (HEMOGLOBIN D)  ali model follow..  16  2.................................LTAEDKKLIQQAWEKAASHQEEFGAEALTRMFTYPQTKTYFPHFDLSPGSDQVRGHGKKVLGALGNAVKNVDNSQAMAELSNLHAYNLRVDPV------NFKLLSQCIQVVLAVHMGKDYTP-------------EVHAAFDKFLSAVSAVLAEKY...... 140
71 -14.5004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  11  1.....................XSRVAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKSPSAKGKFARLGDVSAGKDNSKLRGHSITLMYALQN----ERLKCVVEKFAVNHINRQISADEF----GEIVGPLRQTLKARMGNYFDE-------------DTVAAWASLVAVVQAAL.......... 152
72 -14.5003wr1_A mol:protein length:141 Hemoglobin subunit alpha-A  ali model follow..  12  2.................................LSASDKTNVKGVFAKVGGSAEAYGAETLERMFTYPQTKTYFPHFDLHHGSAQIKAHGKKVAAALVEAANH---DDIAGALSKLSDLHAKLRVDPVN----FKLLGHCFLVVVAIHHPTLLTP-------------EVHASLDKFMCAVAKELTAKY...... 140
73 -14.5001v75_A mol:protein length:141 Hemoglobin D alpha chain  ali model follow..  14  2.................................LTEDDKQLIQHVWEKVLEHQEDFGAEALERMFIYPSTKTYFPHFDLHHDSEQIRHHGKKVVGALGDAVKH---DNLSATLSELSNLHAYLRVDPVNF----KLLSHCFQVVLGAHLGREYTP-------------QVQVAYDKFLAAVSAVLAEKY...... 140
74 -14.4001fsx_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  10  2.................................LSAADKGNVKAAWGKVGGHAAEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVEH---DDLPGALSELSDLHAKLRVDPV----NFKLLSHSLLVTLASHLPSDFTP-------------AVHASLDKFLANVSTVLTSKY...... 140
75 -14.4003vre_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  2.................................LSDNDKTNVKATWSKVGDHASDYVAEALERMFFFPTTKTYFPHFDLSHGSGQVKGHGKKVGEALTQAVGH---DDLPSALSALSDLHAKLRVDPV----NFKLLSHCLLVTLSSHQPTEFTP-------------EVHASLDKFLSNVSTVLTSKY...... 140

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.