current user: public

If you have questions about the server, please let us know.

Query: 2w0c_P mol:protein length:104 PROTEIN P3, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGAAVVVEAPKKAAQPSETLVFGVPQKTLLLGFGGLLVLGLVMRGNKLast
1 -86.1002w0c_P mol:protein length:104 PROTEIN P3  ali model  100  1MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGAAVVVEAPKKAAQPSETLVFGVPQKTLLLGFGGLLVLGLVMRGNK 104
2 -6.8903zif_R mol:protein length:216 PVIII  ali model follow..  15  1MSKEIPTAAAGASQDYSTRMNWFSAGPDMIHDVNNIRDAQNRILMTQSAITATPRNLID............................................. 70
3 -6.8106cfw_I mol:protein length:115 MBH subunit  ali model follow..  19  3.............GYWD-IGLILAYLLNLWAKKSGMGTREVGEGSGEDPEKVIPGFEHLEGYYVNGVKKFFATLKNDHTGLLPDYVLLMTTAFILVILLLRG.. 115
4 -6.7905tx1_U mol:protein length:227 PVIII  ali model follow..  18  1MSKEIPTLAAGASQDYSTRMNWLSAGPSMISRVNGVRSHRNQILLEQAAVTSTPR................................................. 66
5 -5.6703juj_A mol:protein length:281 UDP-glucose pyrophosphorylase (GalU)  ali model follow..  16  3...................................KKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTG............... 56
6 -5.6202e3d_A mol:protein length:302 UTP--glucose-1-phosphate uridylyltransferase  ali model follow..  16  4..............................INTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTH............... 62
7 -5.6104d48_A mol:protein length:302 GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE  ali model follow..  17  7.................................KVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLVTH............... 62
8 -5.5502pa4_A mol:protein length:323 UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE  ali model follow..  14  13...................................KTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAAEAAELGATRLAIITA............... 66
9 -5.4806b1t_O mol:protein length:227 Pre-hexon-linking protein VIII  ali model follow..  18  1MSKEIPTLAAGAAQDYSTRINYMSAGPHMISRVNGIRAHRNRILLEQAAITTTPR................................................. 66
10 -5.4504jd0_A mol:protein length:251 Nucleotidyl transferase  ali model follow..  13  6...................................REAIVLASGAGKRLRSVTGDVPKVFYRFDGCELVKYPMISLMKNGVERFVLVVSEGYRDLGEKVLNDLG 74

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24