current user: public

If you have questions about the server, please let us know.

Query: 2w31_A mol:protein length:162 GLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MLTMQEIKAHYRFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLKEDLVLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASYREEEMRKFFVSHLast
1 -76.2002w31_A mol:protein length:162 GLOBIN  ali model  100  1MLTMQEIKAHYRFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLKEDLVLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASYREEEMRKFFVSH 162
2 -65.7001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  21  32.ADVKKQLKMVRLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLVLE.............. 178
3 -64.4005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  34  7.TVFEELKRYVGWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALGGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHDPPELERVRNALGKVLDLELAVMLHTYRED......... 160
4 -63.6004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  17  2..AMKDEWTGL-VEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDE 162
5 -62.2004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  19  6.KRMKDEWTGL-VEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFLE.......... 157
6 -61.4004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  20  6.EILALRWKDT-SAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLSDQLVKTKLHASMQDWLESVYAAAPTEEYVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASSAAQAAATCRYVADVTMTAVEMMSHAYSVSHDRNARAEE 169
7 -60.1004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  22  48..EQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFLTHEQVKSRLHGTLRQWIVSVFSMSDDDALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRAFSDAYDRNSRSEE 211
8 -58.9002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  18  22LEDLKLLKEAVMFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTNEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVESVPNITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGD....... 194
9 -18.2002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  13  1............MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIEENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFY---IDIEKKLYDK.......... 140
10 -17.8001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  13  1..........VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEAPAAKDLFSTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSD-----ELSRAWEVAYDELAAAIKKA............. 143
11 -16.9001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  12  2............LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIEPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATD-----DILDAWGKAYGVIADVFIQVEADLYAQAVE... 146
12 -16.7001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  13  12..........VSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEAPSASQMFSFKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHF----EVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE........ 166
13 -16.7002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  13  1...MSAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEAPSARQMFPFKTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHF----EVTRFALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE........ 162
14 -16.5003pmd_A mol:protein length:153 Conserved domain protein  ali model follow..  1.............GSHMEATKRYLCLYLKESQEKFISNWKKRILVHEHD---PYKNEIIKNGTHLLHVFTMYMREEINLQDIEDISKKIAQERMDAKVNIADFIYNTNEGKKEILNTLFLLNPTGQECKVVIEQINLFFDHLIYSTIYSYYKLKKEYIHSYY 146
15 -16.4002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  11  1MALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEAPSAKQMFSFKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHF----EVTGFALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPDA........ 165
16 -16.1005v3t_A mol:protein length:132 Globin  ali model follow..  13  1............MSKQPMTPFEAIGG--EQCIEILVDTFYSYVSKHPDLSPIFPDD--LTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPK----RAEAWLSCMEQAMDDTGVHGHIREFVFERLALT........................ 118
17 -16.1003pmc_A mol:protein length:139 Uncharacterized protein pXO2-61/BXB0075/GBAA_pXO2_0075  ali model follow..  11  1.............GSHMEEIKCLLCRYLKERQEKFISDWKKKVIIRERDPY---KEEIIKNGEHLLSAFIMYLKEEISLQEIEITSKKIARERIDAKVNIAEFIHNTNVAKIEIMNILTLLNPDLQQYQALVKKINQFFDHLIYYTVHSYYEQKA....... 139
18 -16.0003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  13  1............MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDEPKVRPLFKIEKQGRKLMDVLNWIVLNLQD----DAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTK-----QLEQLWTQAYEALAQVMIEE............. 132
19 -15.9002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  13  1............MSSETVTLYEAIGG--DATVRALTRRFYELMDTLPEAARCRAIHPALSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPA----ERDEWLLCFRRAMDETIENAKLREIIWAPVERL........................ 121
20 -15.7003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  14  2............IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEPTVSVLFQNSSQSRKLMQVLGILVQGIDN----EGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAKVYGIAAQVM....................... 130
21 -15.7004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  11  31............................EAGALAIANRFYDIMATDEYAKPLYDMHPLLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQD----LRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQL........................ 137
22 -15.5001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  11  52............................REAVEAAVDKFYNKIVADPTVSTYFSNTD-MKVQRSKQFAFLAYALGGA--SEWKGKDMRTAHKDLVPHLSDV----HFQAVARHLSDTLTELGVPPEDITDAMAVVAST........................ 154
23 -15.5003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  12  1...MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEAPSAKNLFSYLKDSPTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSP-----EMKNAWGEAYDQLVAAIKSEMKPSST....... 162
24 -15.4002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  14  10............................EETFTRLARRFYEGVAADPVLRPMYPEED-LGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAE----ERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYA........................ 114
25 -15.3003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  13  7..........IVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEAPTTKKMFSFKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSP-----EMKVAWGQAYDHLVAAIKAEMNLSN........ 160
26 -15.2005d1v_A mol:protein length:127 Globin  ali model follow..  13  13............................EATFRRIVDIFYARVEADPRLRHLFPAD--LEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPR----ERDAWLEHMLAALNEAGVPEPARSVMENYFRHA........................ 116
27 -15.2001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  12............................AKTFDAIVSRFYAQVAEDEVLRRVYPEDD-LAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLI----ERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF............ 128
28 -15.2004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  10  7..........MQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMENPETFQIFPSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPLSSLGAMHTKKKVPTELF----GKLGGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE.............. 154
29 -15.2006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  12  10............................AAAVAATVDVFYKKLMNDPDLEPFFRGVD-MVTLIAKQNRFLAYAFGAT--THYHGKDIV--MGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGV........................ 114
30 -15.1003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  13  1...MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEAPSAKNLFSYKPHATTVFVMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSP-----EMKNAWGVAYDQLVAAIKFEMKPSST....... 162
31 -15.1004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  10  1MQSLQDKASVLSGVDQAEAFAIDESNLFDQTFINLSTNFYTRVYDDEEEWFQIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHTAFFL....................... 144
32 -15.1002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  10  1..........XSLSAKDKANVKAIWGKILPKSDEIGEQALSRMLVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQIDDDDLFGFLTKLSELHAKLRVDPTNFKILAHNLIVVIAAYFPAEFTP-----EIHLSVDKFLQQLALALAEKY............ 142
33 -15.0004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  13  43............................EETFTRLARRFFEGVAADPVLRPMFPEED-LGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAE----ERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYA........................ 147
34 -15.0002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  13  22............................HEAIEVVVEDFFVRVLADDQLSAFFSGTN-MSRLKGKVVEFFAAALGGP--EPYTGA--PMKQVHQGRGITMH----HFSLVAGHLADALTAAGVPSETITEILGVIAPL........................ 122
35 -15.0001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  12...........DLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHDPTAQRKFPTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTK-----QVHDAWAKTFAIVQGVLITKHAS.......... 159
36 -15.0001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  12  2...........ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEAPAAKDLFS-QAHAGKVFKLVYEAAIQLEVTGV-VVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSE-----ELNSAWTIAYDELAIVIKKEMDDAA........ 153
37 -14.9001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  14  22............................HEAIEVVVEDFYVRVLADDQLSAFFSGTN-MSRLKGKQVEFFAAALGGP--EPYTGA--PMKQVHQGRGITMH----HFSLVAGHLADALTAAGVPSETITEILGVIAPL........................ 122
38 -14.9002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  12  13............................EETVAKLVEAFYRRVAAHPDLRPIFPDD--LTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPK----RAEAWLACMRAAMDEIGLSGPAREQFYHRLVLT........................ 116
39 -14.8004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  15  60............................EELLRKLVEVHHENLMKSKIHYLFPTSHEQLRSLVKRSADFVVEMCGGP--PYYTLTRPKMRARHFSVTIDEK----AREIWLACYKHALKDVHFPLSVLEEFWQWIESF........................ 165
40 -14.7001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  13  14............................EELLSQLVDTFYERVASHPLLKPIFPSD--LTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNE----RADAWLSCMKDAMDHVGLEGEIREFLFGRLELT........................ 117
41 -14.5002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  11  3...........HMERPESELIRQSWRVVSRSPLEHGTVLFARLFAEPSLLPLFQSSPEFLDHIRKVMLVIDAAVTNVEDSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTP-----ATRTAWSRLYGAVVQAMSRGWDGE......... 154
42 -14.5001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  10  12...........DLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFADPSAQNKFPSSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNE-----KTRDAWAKAFSVVQAVLLVKH............ 157
43 -14.5002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  1............MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNFPSNLEKFP-RAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKES----YNQLKGVILDVLTAASSLDESQAA---TWAKLVDHVYAIIFKAIDDDGNAK..... 153
44 -14.5004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  19  17............................EAAVEKAVDVFYERIVADPQLAPFFANVD-MKKQRRKQVAFMTYVFGGS--GAYEGRDLG--ASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASA........................ 121
45 -14.4001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  9............................QAAVQAVTAQFYANIQADATVATFFNGID-MPNQTNKTAAFLCAALGGP--NAWTGR--NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTV..................... 116
46 -14.4003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  14  14............................ENAMKAAVPLFYKKVLADERVKHFFKNTD-MDHQTKQQTDFLTMLLGGP--NHYKGK--NMTEAHKGMNLQNL----HFDAIIENLAATLKELGVTDAVINEAAKVIEHT........................ 114
47 -14.4001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  11  1............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFQSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEELASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDGE......... 151
48 -14.4004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  11  1..XVDAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTRPDTKTYFTRLGDVQKGKANLRGHAITLTYA---SRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAALVGVVQAAL....................... 150
49 -14.4004esa_A mol:protein length:143 Hemoglobin alpha chain  ali model follow..  10  1..........XSLSDKDKAAVKLLWSKISKSSDAIGNDALSRMIVYPQTKTYFAHWPDLSPGSPHVKAHGKTVMGGKIDDLRAGLLDLSEQHAYKLRVDPANFKILSHCILVVISMMFPKEFTP-----EAHVSLDKFLSGVSLALSERY............ 142
50 -14.3003bj1_A mol:protein length:142 hemoglobin alpha  ali model follow..  1...........SLSSKDKDAVKALWGKIADKAEEIGADALGRMLAYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGG---DDLNAGLLALSELHATLRVDPANFKILSHCILVQLAVKFPKDFTP-----EVHLSYDKFFSAVARALAEKY............ 141
51 -14.3004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  11  1............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFQSSPEFLDHIRKVMLVIDAAVTNVEDSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDGE......... 151
52 -14.3002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  17  10............................AAAVDLAVEKFYGKVLADERVNRFFVNTD-MAKQKQHQKDFMTYAFGGT--DRFPGRSMR--AAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSV........................ 114
53 -14.2001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  1...........SLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDHDDVFAKFSNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCTFAANHKARGISAGQ----LEAAFKVLAGFMKSYGGDEGAWTAVAGALMGMIRPDM................... 142
54 -14.2004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  11  2............LAEKTRSIIKATVPVLEQQGTVITRTFYKNMLEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDDVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATP-----EIINAWGEAYQAIADIFITVEKKMYEEA..... 144
55 -14.2001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  1...........SLEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFSNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCTFAANHKARGISAGQ----LEAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPDM................... 142
56 -14.1001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  1...........SLSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFSNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCTFAANHKARGISAGQ----LEAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPNM................... 142
57 -14.1003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  11  2...........ECGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKAPSARDMFKRVRGDNIYTPAFRAHATRVLGG---SVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGI....................... 141
58 -14.0001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  4............CGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQSPAARDMFKRVRGDNIHTPAFRAHATRVLGG---PVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGI....................... 142
59 -14.0002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  12  1...........DCTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFAMPDARGLFSRVNGNDIDSSEFQAHSLRVLGG---PVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGI....................... 140
60 -14.0001cqx_A mol:protein length:403 FLAVOHEMOPROTEIN  ali model follow..  13  2............LTQKTKDIVKATAPVLAEHGYDIIKCFYQRMEAHPELKNVFNMAHQEQGQQQQALARAVYAYAENIENSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAA-TDDIISAWAQAYGNLADVLMGMESELYERSAEQP..... 148
61 -13.9001cg5_A mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  12  2............LSSQNKKAIEELGNLIKANAEAWGADALARLFEHPQTKTYFSKFSGFEACNEQVKKHGKRVMNA---DNLHLHLEDLARKHGNLLVDPHN----FHLFADCIVVTLAVNLQAFTP--VTHCAVDKFLELVAYELSSCY............ 140
62 -13.9003mvc_A mol:protein length:161 Globin protein 6  ali model follow..  13  1..........LHLTQPQILFVRKTWNHARNQALEPAISIFRNSFFNPEIRQMIMGHERLKKHAQLFTVLMDDLIANLDSPSATVALREAGEKHVWPPFHAHL----LDQFATAMIERTLEWGEKKDRTETTQRGWTKIVLFVTEQLKEGFQDEQKRA..... 159
63 -13.8001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  14  11............................TTAVDLAVDKFYERVLQDDRIKHFFADVD-MAKQRAHQKAFLTYAFGGT--DKYDGRYMR--EAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAP........................ 115
64 -13.8002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  1............MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKYPHNLNHFPWFKEIPRILRQVDEGVKALSVDFGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKLNEKQVHAYHKFFDRAYDIA....................... 143
65 -13.7002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  2............LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVADG----DDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP-----AVHASLDKFLSSVSTVLTSKY............ 140
66 -13.7001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  10  1...........AFTACEKQTIGKIAQVLAKSPEAYGAECLARLFVHPGSKSYFEYKDYSAA-GAKVQVHGGKVIRA---DDLHSHLETLALTHGKLLVDPQ-----FPMLSECIIVTLATHLTEFSP--DTHCAVDKLLSAICQELSSRY............ 139
67 -13.7001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  11  2............LDAQTIATVKATIPLLVETGPKLTAHFYDRMFHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPGQEVLDAWGKAYGVLANVF....................... 131
68 -13.7001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  13  1..........XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEFPDSANFFAASPKLRDVSSRIFTRLNEFVNNAANAGKMSALSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDAL....................... 142
69 -13.7003uhc_A mol:protein length:146 Globin-1  ali model follow..  8..........AQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DDLVCVVEKFAVNHITRKISAAE----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
70 -13.7003uhd_A mol:protein length:146 Globin-1  ali model follow..  8..........AQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DDLVCVVEKFAVAHITRKISAAE----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
71 -13.6004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  12  1XSRVAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKSPSAKGKFARLGDVSAGKDNLRGHSITLMYA---ERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAASLVAVVQAAL....................... 152
72 -13.6001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  8..........AQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGNVSQGMANLRGHSITLMYA---DDLVCVVEKFAVNHITRKISAAE----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
73 -13.6003uh6_A mol:protein length:146 Globin-1  ali model follow..  8..........AQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSIALMYA---DDLVCVVEKFAVNHITRKISAAE----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
74 -13.6002r4x_A mol:protein length:146 Globin-1  ali model follow..  8..........AQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGVSITLMYA---DDLVCVVEKFAVNHITRKISAAE----FGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
75 -13.6001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  14  1...........SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEFPDSANFFAASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDAL....................... 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.