current user: public

If you have questions about the server, please let us know.

Query: 2wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFRLPGGLast
1 -105.0002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model  100  1MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFRLPGG 393
2 -100.0003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  100  15MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR.... 403
3 -99.5002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  24  32......AERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGV....... 417
4 -98.0004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  23  48......AERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGV....... 433
5 -97.6002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  23  12......AEREALLATGVRDPYAIVMDKVLSPTEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGV....... 397
6 -97.3003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  24  16...........EELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEV....... 394
7 -95.9001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  23  10...QQLTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGV....... 399
8 -95.6005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  22  1MNLLDTLQRGLADLDAQGLRRVRRTADSACDAHMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACQTKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPDSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA......... 393
9 -95.3001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  22  1MSWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLDSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGN............. 383
10 -95.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  22  7...DTLAEGLKEIDARGL-RRRRRTADTPCAAHMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASDVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPDSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA........ 396
11 -94.6003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  22  16...........EGLKKAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEARFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGA....... 398
12 -94.5003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  24  45................................RVRPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAARERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELATIAGVTE---APVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR........ 397
13 -93.3005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  20  18...GLIDSELQKKRLDKSYRYINRLAKEFPLAHRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVPNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQL....... 432
14 -93.3002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  26  40................................RPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAAAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPIDHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA........ 401
15 -93.3004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  21  39................................TPFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDG--KSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYI....... 390
16 -29.6002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  13  1........................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDIEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS........ 371
17 -22.7002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  15  3....................................SDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPPRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGYSVDVKTNMVILRTDNLKNAHGFIEALRNSGVLAN-------AVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS........ 349
18 -22.0004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  15  1........................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDTKLLSLEN--THNGKVLPLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR.......... 333
19 -21.9003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  15  1........................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKTKLLSLENVLPRE----YLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSREQLAEVAAHWRAFLAR.......... 333
20 -20.9005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  52................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFYDELKKRGIAGVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK........ 411
21 -20.6004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  16  21.............................................MRESIKLIASENITSLAVREAHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPDADAMVKKILEEKPKLILFGG--SLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVFTESHQVIIDIDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEGMKEKEMEEIAEFMKRIAID.......... 392
22 -20.4003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  14  2....................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--------EVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAAVLGSVALQPVPMQADGSLALADVRAATRLVCLEN--THNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ---QHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMV-TSGESAPLLAFMKARGILFS---------GYGELRLVTHLQIHDDDIEEVIDAFTEYLGA.......... 341
23 -20.4006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  11  48....................................SGAYLTDPDGRRWIDFDGDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHG-HCDEPFTPNQHGIVEFLFDLDVLAEWLSRPEQAAVVISPDHMHLGE---YTEFTRLTKEADVPVIADEV--VGLRYRAG-------LSTPLLDPAVWIVAKCLAN--AAVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATGE--QQAIRAAGDRFIAHTRAVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAALT........ 389
24 -20.4003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  14  26......................................ASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTGDFRIAGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETY-AEFAESNALELVRRHE------VVTRTLSKSYSLAGGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDRDGKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE........... 353
25 -20.3001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  12  11....................................AKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSEHMVIPKLVYISNTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFP-ENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS.......... 357
26 -19.9006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  12  45....................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLVREATGRPLLLSAGYHGYYPSEAPLENADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGWYRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV----WVVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVAT-GEPQRAVREAGDRFLRHARKLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERLA........ 388
27 -19.8001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  16  22.............................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLHRPKLIVAAA--SAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAGFGLEEMDEIAAIIGLVLKN.......... 386
28 -19.8001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  13  66....................................KGIYLWDVEGRKYFDFLSHPKIVNALKSQVDKLTLTSRA------YNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLAKYKAKIVFAAGNFWGRTLSAISSSTDPTSYIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQT---LARTGR-AVDYENVRPDI-----LLGKALSG--SAVLCDDDIMLTIKPGEHGSTYGGN--PLGCRVAIAALEVLE-EENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNAKDWDAWKVCLRLRDNGLLA-------KPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF......... 439
29 -19.7006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  12  29....................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLVREATGRPLLLSAGYHGYYPSEAPLENADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGWYRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV----WVVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVAT-GEPQRAVREAGDRFLRHARKLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERLA........ 372
30 -19.7003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  14  38.............................................QRDTLEMIASENFVPRAVLQANKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEFRPKVIIAGW--SAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKGTDVHLVLVDLRDSPDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAGFGDTEFTEVADIIATALAT.......... 407
31 -19.5004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  10  36......................................KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPEN---------HDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKAYGLAGGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLALPSATNFVAVDCGKDASRAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA........ 374
32 -19.4003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  14  29.............................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGAQGGHLTHGSPVNFSGKLYNIVPYGDYDEMAKLAKEHKPKMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEKVYQQQVAKNAKAMVEVFLNRGYKVVSGHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAGFKEAEVKELAGWMCDVLDN.......... 395
33 -19.3003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  12  16......................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKAFDIEGLKAAVAYSGPSIVYLVNPNNPTGTITPADVIEPWIASKNTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEG---VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI....... 354
34 -19.3004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  15  30.............................................QEDHIELIASENYTSPAVMAANKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGAHGGHLTHGSPVNMSGKWFNVVSYGDYDAAEKLANEHKPKLIVAGA--SAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAG-----VYPNPVPHADFVTTTTHKSLGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEKEYQQKVVENARVLAETLVKRGLRITESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAGFGPAEAEQVGNLIADVLEN.......... 393
35 -19.3003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  16  25.............................................QNSNIELIASENFVSEAVMEANKYAEGYPGRRYYGGCEVTESIAIDRAKALFGAEHVNV--SGPQANMAVYLVALEMGDTVLGSHGGHLTHGAPVNFSGKFYNFVEYGNYDEVRKLALEHKPKLIVAGA--SAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAG-----LHPNPVEYADFVTTTTHKTLGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNKTYQQQVVKNAKVLAEALINEGFRIDNHLVAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKTSGIRLGTPAGFDEKAFEEVAKIISLALKN.......... 390
36 -19.1003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  13  27......................................NVDIRLNTNE---YPPSEALVADLVATVDK-----IATELNRYPERDAVELRDELAAYITKQTGLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYA-----SPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGYFVANPAFIDAVMLVRLPY----HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSES---VFFGDFSDQHAAWQAFLDRGVLIRDVGIA------GHLRTTIG---VPEENDAFLDAAAEIIKL.......... 364
37 -19.1003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  11  14.................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQKELHPIETILVGAAD--TLDEIKALPDIACLLLELPQREIGAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYE---LRKDRMGQYYEQAKQLAEQFNALP-VPVSNMFHLHFDGQAADISPKLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL......... 352
38 -19.1004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  13  32......................................AVPVRLNTNE---HPPTRALVDDVVRSVRE-----AAIDLHRYPDRDAVALRADLAGYLTAQTGIWAANGSNEILQQLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRADVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYGEFSSQPSAVSLVEEY---PSKLVVTRTMSKAFAFAGGYLIATPAVIDAMLLVRLPY----HLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDA---VLFGEFADAPAAWRRYLEAGILIRDVGIPGY------LRATTG---LAEENDAFLRASARIATDLVPVTRSPVG 379
39 -19.0004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  13  45....................................KGARVWDINGNEYYDFLAHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIAPDSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLK-DEKLADRAERLGAQFRDCLRRE--EIRGRGLLNAVEVDDAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV......... 420
40 -19.0001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  11  25......................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAAYICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLQDEFPAQSLAASIYVETGVRPKLETVRLTIPRRYTYAHMDVVADGIIKLYQH.......... 430
41 -19.0005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  13  65....................................QGARVTDIDGQQYVDFAAQPAVADAIARQARR-------GSTLMLPTEDSLWVGAELARRFGLPYWQVTTSATDANRFVLRMLSGRDKVVVFNCNYHGS-VDESQVEFTTTRLVEFNDLDALEAALAHGDVAAVLTEPFMTNVGMVPPHAGLRELTRRHDVALIIDETHTISC-----AGYSGAHGLEPDF----FVLGKCIAG--AVWGCSQAQAERIWAVLPHF--TLAGNALQLAAMRATFAEVMT-EDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIHARNGLIEACLHLYLLNRGVLLTP----------FHNMALTCPATRAEDVELHDRLLRDCLGEL......... 456
42 -18.9004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  14  59....................................GGCLLRDVEDGEIIDLNADREVLDAVADQFAK-------GHMTGLPHELDARAGALIAELVGVEQVRFANSGTEAVASALRATTGRTLVVTFEGHYHGW-SETVLRAGAHTVQLGWNDPDALRELFARDGDRIVIVEPVLANAGVIPPLQLLRELTGRSGAMLVFDEV--TGFRVARG-GAQERYGVEPDL----TVLSKVMGG--AAFGGRRHAMRMLASNEAHHAGVYAGNHAALRAVVAMLGKIRSLPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVALVDFPRHRRLQTLAQKEGVYFHP---------NALEPWFLSTAHTRDVIDKVAGALQRSLVGLG........ 458
43 -18.8005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  13  3......................................DKSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHVETDECEFFSNGSKLLTAASTPQSIREVALKRQDIHYPKPRVVTITGTVYRLKAISATCKELGLNLHMDGARFTNACAFLGCSPAE-LTWKAGVDVLCFGGTKNGMAGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT........... 345
44 -18.8004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  13  60....................................KGARVWDINGNEYYDFLAHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIAPDSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLK-DEKLADRAERLGAQFRDCLRRE--EIRGRGLLNAVEVDDAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV......... 435
45 -18.7001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  13  26.............................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEIVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLEPGDTVLGAHGGHLTHGSPVNFSGKLYNIVPYGDYADLEKQAKEHKPKMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEKTYQQQVAKNAKAMVEVFLERGYKVVSGHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRVGTPAGFKEAEAKELAGWMCDVLDS.......... 392
46 -18.6001v72_A mol:protein length:356 Aldolase  ali model follow..  14  5....................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHINNDECEFFSNGAKLMTVDGDIVRLRERTREKVQPACVSITQATEVGSIYTIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAE-MTWKAGVDALSFGATKNGVLAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLT------RNARKANAAAQRLAQGLEGLGVLGGTEANILFCRLDSA-----MIDALLKAGFGFY-----HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ........ 354
47 -18.5002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  15  22.............................................QREGLELIASENFVSKQVREANKYAEGYPGARYYGGCERVESLAIERAKALFGAAWANV--SGSQANMAVYMALMEPGDTLMGAAGGHLTHGSRVNFSGKLYKVVSYGDLEEVRRLALEHRPKVIVAGA--SAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLGPRGGLILSNDELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEKEYSRLVVENAKRLAEELARRGYRIVTGHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPTSGIRIGTPAGFTPEEMPLVAELIDRALLE.......... 387
48 -18.4002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  17  42....................................EGAYVWDADGNRYLDYVAHPKVLARVRETLER-------GLTFGAPSPLEVALAKKVKRAYFVDLVRFVNSGTEATMSALRGYTGRPYIVKFRGNYHGH-ADGLLVEAGSTLVLEYNDPEGLREVLKRRGEEIIIFEPVVGNAGVLVPTEDFLKEAKAYGVLLIADEV--TGFRLAFG-GATELLGLKPDL----VTLGKILGG--AAYAGRREIMEKVAPLGPVYQAGTSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNDARRTDTELFKRFFHGLLDRGIYWPP---------SNFEAAFLSVAHREEDVEKTLEALRKAL............ 424
49 -18.4004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  12  57.............................................QIETINLIASENLTNTAVRECNKYSEGYPHKRYYGGNDKIEELCYKRALEAFNVSEEEWGVSGSAANVQALYALVGVKGKIMGMHLCHLTHGFFDEKKKVSITSDLFEDMESVRNLALSFQPKVIICGY--TSYPRDIDYKGFREICDEVNAYLFADISHISSFVA---CNLLNN---FTYADVVTTTTHKILGPRSALIFFNKKRNPGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVKEYTKQVLLNSKALAECLLKRNLDLTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDVDSPSGIRIGTPAGCKEKDMEFIADMLLKAIL........... 431
50 -18.4005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  15  25.............................................QNEHLEMIASENYTFPSVMEANKYAEGYPNKRYYGGCEKIESLAIERAKKLFNCQFANV--SGSQANNAVYHALLKPYDKILGSCGGHLTHGAKVSLTGKHYQSFSYGDYEEALKIAQSVKPEIIVCGF--SAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTN-----EHAHPFPHCHVVSSTTHKTLGPRGGIILTNEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEKAYAKLVKSNMQVLAKALKEKNHKLVSGHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSTSGIRIGSAAGMGAKEFEIIGNKISDILND.......... 389
51 -18.4003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  15  31.............................................QQSQVELIASENIVSRAVLDANKYAEGYPGKRYYGGCEEVEALAIERVKRLFNAGHANV--SGAQANGAVMLALAKPGDTVLGDAGGHLTHGAKPALSGKWFNALQYGDYDQVEALAQQHKPSLIIAGF--SAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLGPRGGFVLTNEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDKTYIDRVLANAQALGDVLKAGGVDLTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKTSGIRLGTPAGFGAAEFREVGRLILEVFEA.......... 396
52 -18.4003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  13  24.............................................QCEGLEMIASENFTLPEVMEVNKYAEGYPGKRYYGGCEEIETLAIERCKKLFNCKFANV--SGSQANQGVYAALINPGDKILGSHGGHLTHGAKVSSSGKMYESCFY-DYEKVREIAKKEKPKLIVCGA--SAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAG------HPSPFPYAHVVSSTTHKTLGPRGGIIMTNEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEKVYAKQVRTNAQVLANVLMDRKFKLVSDHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSTSGLRLGTPAGFKEKEMEIVSNYIADILDD.......... 388
53 -18.4006MME Entity 1(prereleased)  ali follow..  11  25......................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAAYICLAVTVNLAGSMANMRAVRELTEAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLQDEFPAQSLAASIYVETGVRPKLETVRLTIPRRYTYAHMDVVADGIIKLYQH.......... 430
54 -18.3003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  11  30......................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSIEFKKLYETHKD-EIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLYGLGGGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDEKNSTDLSEKLLKKGIIIRNLKSYGLN-----IRITIG---TSYENEKFFTEFDKILR........... 365
55 -18.3003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  12.............................................QGMLNFTVGPVMSSEEVRAIGAEQVPYFRTTEFSSTMLENEKFMLEYAKAPEGSKAVFMTCSSTGSMEAVVMNCFTKKDKVLVHRFVQLCEIHEIPYVALKLEHGKKLTKEKLYEYDNQNFTGLLVNVD--TSTAVLYDTMMIGEFCKKNNMFFVCDCVSAFL---------ADPFNMNEGADVMITGSQKVLACPPGVIVLAPRGVERVEKSKVRTMYPFTPAVGILLQINERLKEIKKHDAEVARIASQAADFRAKIKDLPFELVSESPVTSVHPTTANAYDIFLKLKDEYGIWICP------EMKDTIFRVGHIGALTHEDNTTLVNAFKDLQKRNLL....... 370
56 -18.3004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  15  26.............................................QSSVIELIASENFVSPAVLEANKYAEGYPSKRFYNGCEKAENLAIERVKKLFNCKYANV--SGSQANQAVYLALLQPGDTVLGDSGGHLTHGAAPNMSGKWFNAVSYSDYDEIERLADLHKPKLLIAGF--SAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATG-----EHQSPIPYAHAVTSTTHKTLGPRGGLILSNDEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEKSYIQQVISNAKALASSLQERGYDILTGHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSTSGIRLGTPAGFKEKDFVLVGHMVADILDG.......... 391
57 -18.2004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  12  23......................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTDLYAMLATDRTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKAYGLAGGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQA---VWLPLGSRTQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSD.......... 353
58 -18.2002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  15  84....................................TGSRFQDVDGHAYVNFLSHPVIRAAVERALAV-------GLNLSTQTENEALFAEAVCDFPSIDLVRFTNSGTEANLMALAAITGRKTVLAFDGGYHGG-LLNFASGHAHVVLGVYNDVEGTADLLKRHGHDCILVEPMLGAGGCVPALDLLRAEASRCGALLIFDEV----MTSRLSGGAQEMLGISADL----TTLGKYIGG--GAFGGRRDLMERFDPARDGAFAHAGT-ILTMSAGHAALTQIYT-RQAASDLSASGDRFRANLNRIAVENQAPLQFTDVRAADQQLKELFFFHMLRKGIYLAP-------------MYALSLEIADAGRDAFAEALADFIGEQR........ 455
59 -18.2005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  14  8.NSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAVNQG--SHPKIVEALVEQASKLALTSRA------YNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLAENAAKIIVCENNFHGRTTTIVSFSNDPDANIPYNDIAALEEVLSKEAGNIFLVEPIQGEAGVYVPLKQSSELCKKHNVLFIADEVQT---IARTGK-ACHHEDVQPDI-----ILGKALSG--SAVLANNNIMDVIKPGQHGSTFGGN--PLACAVAMAALDVVQ-DEKLSERAEKLGNLFRSEIEKLIEKTDLITKVKGLLNADSSTAWNLCLALKENGLLA-------KPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF......... 413
60 -18.2002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  14  47....................................QGVHKTDVDGNVYLDFFGHPRVNAAIAEALSH-------GVQYAASHPLEVRWAERIVAAFSIRKLRFTGSGTETTLLALRAFTGRRMILRFEGHYHGW-HDFSASGYANTLLIRPDDIEGMREVFANHGSDIFIAEPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASAG--GILGGREDVMGVLSRGSDRKVLHQGT-PITAAAAIAAIDTILE-DDVCAKINDLGQFAREAMNHLFARKGLNWLAYEVARPDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRL......... 435
61 -18.2004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  15  32.............................................QQNNIELIASENVVSKAVMAANKYAEGYPGKRYYGGTAVVETLAIERAKKLFGAKFANV--SGSQANAAVYMSLIQPGDTVMGSAGGHLTHGAPVSFSGKTYNFVSYNDYDAILAQAKEVRPKLIVAGA--SAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASG-----HHPSPVPYAHVTTTTTHKTLGPRGGLILTDDEIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAKEYGENVIKNAAAMADVFNQHPDFRGTNNHLFLVDVTKVVNGKVAQNVLEEVNITLNKNSIPYEQLSTSGIRVGSPAGMGEAESRQIAEWMVEALEN.......... 398
62 -18.1006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  14  47....................................QGVHKTDVDGNVYLDFFGHPRVNAAIAEALSH-------GVQYAASHPLEVRWAERIVAAFSIRKLRFTGSGTETTLLALRAFTGRRMILRIATHYHGW-HDFSASGYNNTLLIRPDDIEGMREVFAQHGSDIFIAEPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASAG--GILGGREDVMGVLSRGSDRKVLHQGT-PITAAAAIAAIDTILE-DDVCAKINDLGQFAREAMNHLFARKGLNWLAYEVARPDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRL......... 435
63 -18.1003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  14  36....................................KGVFVYDIEDRRYYDFLSHPDILNAMINQAKKLTICSRA------FSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCENSAKIIVCNNNFSGRTLGCVSASTDKKCKVPYDDLEALEKELQDPNVCAFIVEPVQGEAGVIVPFPGVASLCKKYNVLFVADEVQT---LGRTGK-CTHHYGVKPDV-----LLGKALSG--SAILANDDVMLVLKPGEHGSTYGGN--PLAAAICVEALKVLI-NEKLCENADKLGAPFLQNLKEQLKDSKVVREVKGLLCADLVNVWDICLKFKENGLIT-------RSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFFD........ 411
64 -18.1003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  14  16......................................AQAVCLAFNE---EAVEPRVQAAIAAAAARINRYPFDAE---------PRVMRKLAEHFSCPDNLMLVRGIDECFDRISAEFSSMRFVTAWP-GFDGYRARIAVSGLRHFEIGLTD--DPNDLAQVSRDDCVVLANPSNPTGQALSAGELDQLRQR--GKLLIDETY-VDYSSFRARGLAYGENE-----LVFRSFSKSYGLAGGALFGPSELIAAMKRKQWFC----NVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVSSEANFVLVENAAGE---RTLRFLRERGIQVKDAGQFGLHH----IRISIG---REEDNDRLLAALAEYSDH.......... 336
65 -18.0001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  14  49....................................KGVFVYDVNDKRYYDFLSHPNILNAMINQAKNLTICSRA------FSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCENMAKIVVCKNNFSGRTLGCISASTTKKCTVPYDDLEALEEELKDPNVCAFIVEPIQGEAGVIVPLQGVYDICKKYNVLFVADEVQT---LGRTGK-CVHHYNVKPDV-----LLGKALSG--SAVLANDDIMLVIKPGEHGSTYGGN--PLAASICVEALNVLI-NEKLCENAEKLGGPFLENLKRELKDSKIVRDVKGLLCAELVNVLDICLKLKENGLIT-------RDVHDKTIRLTPPLCITKEQLDECTEIIVKTVKFFD........ 424
66 -18.0005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  14  52....................................RGAVIVDADGEERLDFVADPDINEAVIRQLAD-------GVAFAMPTEHEIALAELLTEVPSLQQVRFTNSGTEAVMMAIKAYTGRPRIAKFDGCYHGS-YDFAEVSTQSVVVLPFNDIDGTERLIEQHRDELVLIDPNPRSLGLYPALQRLREITRAYGIVLIFDEVISLRS-----GGMQSVLGVTPDL----TAMGKIIGG--GAVGGSAEVMSVFDPTGGP---TFNANPVTMVAGLTAMRKLT--PAEFDRLATLGQQLRAGVEEVPGQVTGYGSLFHIHLHERAFVGRVHEALMGRGIFITP-------------FGCLSTPMGVPEVEAFVDAFAAALQDAR........ 445
67 -18.0006blg_A mol:protein length:379 dTDP-4-amino-4,6-dideoxygalactose transaminase  ali model follow..  12  1.............................................SNAMIPFNA-PPVVGTELDYMQS----AMNSGKLCGDGGFTRRCQQWMEQRFGTAKALLTPSCTASEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIV---NIDETLIEAAITDKTRAIVPVH----YAGVACEMDTIMAIADKYNLFVVEDAAQGVMSLGTIGHIGCFSFHETKNYT--------AGGEGGATLINDRTLVERAEIIREKGTSSYLMSDLQAAYLWAQLEAAERINQQRLALWQNYYDALLPLARAG-DCGQNAHMFYIKLRDIEDRSRLIAWLKEAEILAVFHYIPTTQESERLVRLPLFYNLSVVNQRTVINSLLSYFS........... 379
68 -18.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  13  51.............................................QCRGLELIASENFCSRAALEANKYSEGYPGKRYYGGADEIELLCQRRALEAFDLDPAQWGVSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIDYNQLALTARLFRPRLIIAGT--SAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAK-----VIPSPFKHADIVTTTTHKTLGTRSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMREYSLQVLKNARAMADALLERGYSLVSGHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSTPGGLRLGAPAQFREDDFRRVVDFIDEGVNI.......... 438
69 -17.9003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  15  26....................................EGVWVEDPEGNRYMDLLSHPKIINALIDQANRVTLTSRA------HSDQLGPWYEKVAKLTNKEMVLPMNTGAEAVETAIKTAANRAEIIVCEDNFHGRTMGAVSMSSNEEYKIPYGDLEALKAAITPNTAAFIL-EPIQGEAGINIPLKEALEVCKKENVLFVADEIQT---LGRTGK-ACDWDNVTPDM-----ILGKALGG--SCAAANRDILGVFEPGSHGSTFGGN--PLACAVSIAALEVLE-EEKLTERSLQLGEKLVGQLKEIDNPMITEVRGKGLFIG-NEPARPYCEQLKAAGLLC-------KETHENVIRIAPPLVISEEDLEWAFQKIKAVLS........... 392
70 -17.9004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  16  71....................................EGAALWDADGHRYADFISAPEIRDAVIEAMQG-------GINLTGHNLLEGRLARLICEFPQIEQLRFTNSGTEANLMALTHFTGRRKIVVFSGGYHGGV-LGFGARPSDFLVLPYNDAQTARAQIERHGPEIVLVEPMQGASGCIPGLQALRESATQVGALLVFDEV----MTSRLAHGLANKLGIRSDL----TTLGKYIGG--GAFGGRADVMALFDPRTGPLAHSGTFNVMTMAAGYAGLTKLFT-PEAAGALAERGEALRARLNALCANEGVAMQFTDLAAVDGRLRQLLFFHLLNEDIYSSP-------------FVVLSLPLTDADIDRYVAAIGSFIGGHG........ 441
71 -17.8002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  14  47....................................KDAYAWDVDGNRYIDYVAHPEVIEALKVAMEK-------GTSFGAPCALENVLAEMVNDAVSIEMVRFVNSGTEACMAVLRAYTGRDKIIKFEGCYHGH-ADMFLVKAGSTLTTPYNDLEAVKALFAENPGEIVILEPIVGNSGFIVPLEGLREITLEHDALLVFDEV--TGFRIAYG-GVQEKFGVTPDL----TTLGKIIGG--GAYGGKREIMQLVAPAGPMYQAGTSGNPLAMTAGIKTLELLRQ-PGTYEYLDQITKRLSDGLLAIAQETGHAACGGDAKKSDLQKFSRFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEEDIDATLAAARTVMSAL......... 432
72 -17.8002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  16  26....................................KGAHIWDVDGNQYIDYVAHPEVIDALHAALEK-------GTSFGAPCLLENILAEMVIAAVSVEMVRFVNSGTEACMAVLRAYTQREKVIKFEGCYHGH-ADMFLVKAGSTLTAPYNDLEAVSRLFEQYPNDIVILEPVVGNAGFIPPLEGLRELTKQYGALLVFDEV--TGFRIAYG-GAQEKFGVTPDL----TTLGKVIGG--GAYGGRAEIMKMVAPAGPVYQAGTSGNPLAMTAGIKTLEILSR-PGSYEHLDRITGKLVQGLLDAAREFGHEVCGGQAKQSDLKKFAAFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEADIERTIAAARTVLSQL......... 411
73 -17.8005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  13  27.............................................QEAHIELIASENYCSPAVMEANKYAEGYPGKRYYGGCEVIEQMAIDRAKELFGADYANV--AGSQANSAVYLALLNPGDTVLGAHGGHLTHGAKVSFSGKTYNAVQYGDYEEVERLALEHKPRMIVAGF--SAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAG-----VYPNPVQIADVTTTTTHKTLGPRSGLILAKANIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDKAYQQQVVKNAQAMAEVFIARGYDVVSGHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSTSGIRIGTPAGFGEAEVRELAGWIADVIDS.......... 393
74 -17.8001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  14  9......................................HQFPGLANKTYFNFGGQGILPTVALEAITAMENGPFSIAANQHIQQLIAQLRQALAETFNVDPTITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIFGITYRFFPVAATLNQAAAVLANHLGP-KTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGRVLVDGAQSAGFAGPAGVGGL-HGDCLGEINPTY---------VGWRSITYGAKGEPTGWAEGGKRFEVATSAPQYAGLLAALQLHQRAEERYQAICQRSEFLWRGLNQLP-TSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDC------IRACCHYITDEEEINHLLARLADFG............ 389
75 -17.8003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  12  27................................RLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--LPQLEAIHYYRENSDLLRKALLATGFEVFGGEHLWVKPTQANISDRDLFDFFLRE---YHIAITPGIRSGSGFVRFSSLG--KREDILAACERLQMAPALQS........ 394

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.