current user: public

If you have questions about the server, please let us know.

Query: 2wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDKLast
1 -73.1002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model  100  1MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK 140
2 -68.3001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  47  2LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAKHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGATDDILDAWGKAYGVIADVFIQVEADLYAQ 143
3 -62.0003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  25  1MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDVEPKVRPLFKIDIE---KQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGWTKQLEQLWTQAYEALAQVMIE........ 131
4 -61.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  26  2IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEEPTVSVLFQNPIS---SQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGFTEEAKAAWTKVYGIAAQVMTA........ 132
5 -59.3001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  18  3FTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSPTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGWSDELSRAWEVAYDELAAAIKKA....... 143
6 -58.4001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  22  3LTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGWSEELNSAWTIAYDELAIVIKKEMDDA... 152
7 -58.3001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  19  1MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGFTPATRAAWSQLYGAVVQAMSRGWDG.... 150
8 -57.9001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  21  2LSAAQRQVVASTWKDIAGNGAGVGKECLSKFISAHPEMAAVFGFSGASDPGLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGMNAAAKDAWAAAYGDISGALISGLQS.... 147
9 -57.8004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  19  1MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGFTPATRAAWSQLYGAVVQAMSRGWDG.... 150
10 -57.8001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  19  2LSAAQRQVVASTWKDIAGNGAGVGKECFTKFLSAHHDMAAVFGFSGASDPGLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGMNAAAKDAWAAAYADISGALISGLQS.... 147
11 -57.5002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  18  4MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGFTPATRTAWSRLYGAVVQAMSRGWDG.... 153
12 -56.9004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  18  9VSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMEENPETFQIFPRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSWSEEKKEAWLKAYGIITVMVTE........ 154
13 -56.9001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  19  2LSAAQRQVIAATWKDIAGNGAGVGKKCLIKFLSAHPQMAAVFGFSGASDPGLGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGMNAAAKDAWAAAYADISGALISGLQS.... 147
14 -55.6003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  20  10FTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPHATTVFVMTCESAVQLRKAGKKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPWSPEMKNAWGVAYDQLVAAIKFEMKPSST. 162
15 -55.5003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  19  4LTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCHVEGSTKNAWEDFIAYICRVQGDFMKER... 151
16 -55.4002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  18  10FSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALPWGPEMRNAWGEAYDQLVAAIKQEMKPA... 161
17 -55.4001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  14  2LSAAEADLAGKSWAPVFANKNANGDAFLVALFEKFPDSANFFADASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGK..... 146
18 -55.4003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  18  9FTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPHAMSVFVMCCESAVQLRKTGKRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPWSPEMKVAWGQAYDHLVAAIKAEMNL.... 158
19 -55.3001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  20  14FSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPWSPAMKSAWSEAYDHLVAAIKQEMKPA... 165
20 -55.3002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  20  4LTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKAHPETLTPFKSDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMEDHNHMVGGAKDAWEVFVGFICKTLGDYMKEL... 151
21 -55.1002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  21  13FGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFEVTGFALLETIKEALPWSLEMKKAWAEAYSQLVAAIKREMKP.... 163
22 -55.1003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  19  10FTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPWSPEMKNAWGEAYDQLVAAIKSEMKPSST. 162
23 -55.0001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  14  3LSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFAKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGA..... 147
24 -54.2004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  16  13SNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKTSPSAKGKFAKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGFDEDTVAAWASLVAVVQAAL.......... 152
25 -53.4004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  13  11GSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGYSDDVAGAWAALVGVVQAAL.......... 150
26 -52.9001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  37  2LDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPGQEVLDAWGKAYGVLANVFINREAEIYNE 141
27 -52.7002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  15  1MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPSGNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAASSLDESQAATWAKLVDHVYAIIFKAIDDDGNA 152
28 -52.3001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  14  4CGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQHSPAARDMFKRHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGIQG........ 144
29 -52.1001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  14  13LTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGFTKQVHDAWAKTFAIVQGVLITKHAS.... 159
30 -52.1003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  13  3CGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKVAPSARDMFKRYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGIQG........ 143
31 -51.9004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  41  2LAEKTRSIIKATVPVLEQQGTVITRTFYKNMLTEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDDLSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGATPEIINAWGEAYQAIADIFITVEKKMYEE 143
32 -51.8002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  14  2CTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFANMPDARGLFSRDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG........ 142
33 -51.3001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  16  13LTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGFNEKTRDAWAKAFSVVQAVLLVKHG..... 158
34 -51.0001cqx_A mol:protein length:403 FLAVOHEMOPROTEIN  ali model follow..  39  2LTQKTKDIVKATAPVLAEHGYDIIKCFYQRMFEAHPELKNVFNMAHQEQGQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGATDDIISAWAQAYGNLADVLMGMESELYER 143
35 -50.9002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  12  2LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKGKKVADGLTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPFTPAVHASLDKFLSSVSTVLTSKYR..... 141
36 -50.7002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  15  1MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKKYPHNLNHFPWENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKLNEKQVHAYHKFFDRAYDIAFAEMAKM... 150
37 -50.5003a0g_A mol:protein length:141 Hemoglobin subunit alpha  ali model follow..  14  2LSAADKNNVKTTWDKIGGHAAEYVAEGLTRMFTSFPTTKTYFHHGSGDIKAHGKKVADALTTAVGHLDDLPTALSTLSDVHAHK--LRVDPVNFKFLNHCLLVTLAAHLGFTPSIHASLDKFFASVSTVLTSKYR..... 141
38 -50.3001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  12  2LEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD----EGAWTAVAGALMGEIEPD....... 141
39 -50.2001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  13  2LSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGD----EGAWTAVAGALMGMIRPD....... 141
40 -50.2001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  12  2LSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD----EGAWTAVAGALMGEIEPN....... 141
41 -50.2001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  10  5LSDSEEKLVRDAWAPIHGDLQGTANTVFYNYLKKYPSNQDKFETDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHVARPITHGSYNDLRGVIYDSMH----LDSTHGAAWNKMMDNFFYVFYECLDGRCSQ 150
42 -50.1002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  11  2CNRLEQILVKTQWAQSAENRAAFSRDLFSELFNIQGSSRALFSGNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTHLD--CFNQHAWGECYERIASGISG........ 140
43 -50.0001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  19  2FTACEKQTIGKIAQVLAKSPEAYGAECLARLFVTHPGSKSYFEYKDYSAAGAKVQVGKVIRAVVKAAEHVDDLHSHLETLALTHGKLLVDPQNFPMLSECIIVTLATHLTFSPDTHCAVDKLLSAICQELSSRYR..... 140
44 -49.9001g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  12  2LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKGKKVGDALTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPFTPAVHASLDKFLSSVSTVLTSKYR..... 141
45 -49.8003uhc_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
46 -49.8003uh6_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
47 -49.8003uhb_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
48 -49.7002r4x_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
49 -49.7003uhd_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
50 -49.7003ugz_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
51 -49.7004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  12  3CDVLTRLKVKAQWRRAYSHGEDFAQAIWRALFAQVPDSRTLFKRTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRC--DKDAWSACFDHIAHGIKG........ 142
52 -49.7003uhi_A mol:protein length:146 Globin-1  ali model follow..  12  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
53 -49.6001hbr_A mol:protein length:141 PROTEIN (HEMOGLOBIN D)  ali model follow..  16  2LTAEDKKLIQQAWEKAASHQEEFGAEALTRMFTTYPQTKTYFPPGSDQVRGHGKKVLGALGNAVKNVDNLSQAMAELSNLHAYN--LRVDPVNFKLLSQCIQVVLAVHMGYTPEVHAAFDKFLSAVSAVLAEKYR..... 141
54 -49.6002grf_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
55 -49.6003ugy_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
56 -49.6001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
57 -49.5003mkb_A mol:protein length:140 Hemoglobin subunit alpha  ali model follow..  19  2FTGVERSTIGAIAKILASTPEAYGAEALARLFATHPGAKSYFDYADYSAAGAKVQLGKVIRAVVSAAEHDDDLHAHLMVLAVTHGKLLVDPSNFPMLSECILVTLATHLAFSPATHCAVDKLLSAISSELSSKYR..... 140
58 -49.5001jeb_A mol:protein length:142 HEMOGLOBIN ZETA CHAIN  ali model follow..  15  3LTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYI--LRVDPVNFKLLSHCLLVTLAARFPFTAEAHAAWDKFLSVVSSVLTEKYR..... 142
59 -49.5002auo_A mol:protein length:146 Globin I  ali model follow..  13  10LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
60 -49.4003a59_A mol:protein length:141 Hemoglobin subunit alpha-A  ali model follow..  14  2LSGTDKTNVKGIFSKISSHAEEYGAETLERMFITYPQTKTYFPHGSAQIKAHGKKVANALIEAVNHIDDISGALSKLSDLHAQK--LRVDPVNFKLLGQCFLVVVAIHHPLTPEVHASLDKFLCAVGAVLTAKYR..... 141
61 -49.4004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  16  2CSILELLKVKNQWREAGHHRVQFGLELWKRFFDTHPEVKGLFKGYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLG-TKLDQDAWTKCFHTIADGIKG........ 141
62 -49.3002r4z_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVWGSDKKGNGVALMTTLFADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLAS--NFGDKYANAWAKLVAVVQAAL.......... 146
63 -49.2001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  12  3LSEDQEHYIKGVWKDVDH--KQITAKALERVFVVYPWTTRLFSKLQGLFSANDIGVDKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKFRPKEHAAAYKFFRLVAEALSSN....... 139
64 -49.2003d1a_A mol:protein length:142 Hemoglobin subunit alpha-1/2  ali model follow..  14  3LSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHGSAQVKGHGEKVAAALTKAVGHLDDLPGTLSDLSDLHAHK--LRVDPVNFKLLSHSLLVTLACHLPFTPAVHASLDKFLANVSTVLTSKYR..... 142
65 -49.2001v75_A mol:protein length:141 Hemoglobin D alpha chain  ali model follow..  18  2LTEDDKQLIQHVWEKVLEHQEDFGAEALERMFIVYPSTKTYFPHDSEQIRHHGKKVVGALGDAVKHIDNLSATLSELSNLHAYN--LRVDPVNFKLLSHCFQVVLGAHLGYTPQVQVAYDKFLAAVSAVLAEKYR..... 141
66 -49.2001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  15  19LSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQRSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFAFPPETQRAWAKLRGLIYSHVTAAYKEVGWV 172
67 -49.2003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  13  2CNILQRLKVKMQWAKAGTERAKFGNSLWTSIFNYAPDARDLFKSRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVC--DLPAWESCYKVIAMGITGNDMFS... 146
68 -49.0001xz7_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  14  2LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHGSAQVKGHGKKVADALTNAVAHVDDMPNALSAL--SDLHAHKLAVDPVNFKLLSHCLLVTLAAHLPFTPAVHASLDKFLASVSTVLTSKYR..... 141
69 -48.8002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  11  3LSAKDKANVKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYFSHWASVAPGSAPHGITIMNQIDDCVGHMDDLFGFLTKLSELHAKLRVDPTNFKILAHNLIVVIAAYFPFTPEIHLSVDKFLQQLALALAEKYR..... 143
70 -48.8003cy5_A mol:protein length:141 Hemoglobin subunit alpha-2  ali model follow..  14  2LSAADKSNIQAAWGKVGGHAADYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGAKVANALTKAVGHLDDLPGALSELSDLHAKLRVDPVNFKLLSHSLLVTLASHLPFTPAVHASLDKFLASVSTVLTSKYR..... 141
71 -48.6001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  11  2CAMLERAKVKDEWAKAGAARSKFGDALWRNVFNYAPNARDIFESASPEFKAHIARVLGGLDRVISMLDNQATLDADLAHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVC--DVPAWQGCYNIIAKGITGSDAA.... 145
72 -48.5005jgg_A mol:protein length:142 Alpha chain  ali model follow..  14  2LTSADKSHVKSIWSKASGKAEELGAEALGRMLEVFPNTKTYFSVTSGQVHTHGKKILDAITTAVNHIDDITGVLTALSTLHAKT--LRVDPANFKILSHTILVVLALYFPFTPEVHLACDKFLASVSHTLATKYR..... 142
73 -48.5001iwh_A mol:protein length:141 Hemoglobin alpha chain  ali model follow..  14  2LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLH--AHKLRVDPVNFKLLSHCLLSTLAVHLPFTPAVHASLDKFLSSVSTVLTSKYR..... 141
74 -48.4001hds_A mol:protein length:141 HEMOGLOBIN S (DEOXY) (ALPHA CHAIN)  ali model follow..  12  2LSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLSFPTTKTYFPHFDLSHGSAQQKAQKVANALTKAQGHLNDLPGTLSNLSNLHAKLRVNPVNFKLLSHSLLVTLASHLPFTPAVHANLNKFLANDSTVLTSKYR..... 141
75 -48.4002qmb_A mol:protein length:142 Hemoglobin subunit alpha-A  ali model follow..  12  3LSAADKNNVKGIFTKIAGHAEEYGAETLERMFITYPPTKTYFPHFDLSHGSAQIKGKKVVAALIEAANHIDDIAGTLSKLSDLHAKLRVDPVNFKLLGQCFLVVVAIHHPLTPEVHASLDKFLCAVGTVLTAKYR..... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.