current user: public

If you have questions about the server, please let us know.

Query: 2x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst ADLLSKFDPLIAEREALLATGVRDPYAIVMDKVLSPTEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVIPKLAAALELast
1 -115.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model  100  1ADLLSKFDPLIAEREALLATGVRDPYAIVMDKVLSPTEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVIPKLAAALE 406
2 -109.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  34  5...LGEKISQFKIVEELKAKGLYAYFRPI--QSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLG--ATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVET....... 396
3 -109.0002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  74  22.DLLSKFDGLIAERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIG....... 419
4 -107.0004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  74  38.DLLSKFDGLIAERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVI........ 434
5 -106.0001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  33  6...GEFYQQLTNDLETARAEGLFKEERIITSAQQADITV-ADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLA--GADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIA....... 401
6 -104.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  30  3...MHLLDTLAEGLKEIDARGLRRRRRTA--DTPCAAHMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASDAD-VKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPV--DSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA.......... 396
7 -104.0003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  31  2NAMQEILSQLNKEIEGLKKAGLYKSERII--TSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKRFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLV--PGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI........ 399
8 -104.0001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  29  1...MSWQEKINAALDARRAADALRRRYPVAQ--GAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPG-QQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLA--DSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG.............. 384
9 -104.0005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  31  1...MNLLDTLQRGLADLDAQGLRRVRRTA--DSACDAHMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACTSQ-TKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPV--DSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA........... 393
10 -103.0003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  32  22...LSPLAWLADIEQRRRAEGLRREL-----------RVRPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAARTEE-RAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELATIAGVTE------APVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR.......... 397
11 -101.0004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  25  17....NAMLNLQDKYTQYQRDNLLREL-----------TPFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDG-----KSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELV-SKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIRSN...... 393
12 -100.0002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  27  1...MDYNLALDKAIQKLHDEGRYRTFIDIEREKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPII--DHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA.......... 401
13 -99.6005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  24  11ESGFDYEGLIDSELQKKRLDKSYRYFNNINRKEFPLAHRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVI--PNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLPRVRDWESQ 441
14 -97.6002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  23  7...........PDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHG---PGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIR---SESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF......... 386
15 -95.6003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  23  21...........PDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHG---PGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIR---SESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF......... 400
16 -29.9002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  16  1.............................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCT-TPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTTPENFAQTIEETKKRGEVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS.......... 371
17 -23.8002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  19  3.........................................SDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPRNIHRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKNAHGFIEALRNSGVLA-------NAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS.......... 349
18 -22.6004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  1.............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV---GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR............ 333
19 -22.3003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  16  1.............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRV---GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR............ 333
20 -22.0005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  15  52.....................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNLEDKGKGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGKQLGIKPKEHDLIKFETPDKRRGFFFYDELKKRGIGGIRA------GVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK.......... 411
21 -21.6003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  17  2.........................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--------EVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ---QHVVRLADDHRRARQLAEGLAALGIRLDLAQVQTNMVFLQL-TSGESAPLLAFMKARGILF---------SGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA............ 341
22 -20.5004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  15  36...........................................KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPEN---------HDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKAYGLAGGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASYARAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA.......... 374
23 -20.0006DK6 Entity 1(prereleased)  ali follow..  16  34.........................................AAQRLIRCGIGD--TEALPEAVRYAMHEAVDELGNRSTFKGYEQGYDFLRNAIADNDYKARGLPDEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLNGFVPDIPQEKADLIYLCYPNNPTGAVATLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGAYVVIPKSLMGRKKNGEAQALHPNGASYIVQKGAEALYT--SQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITP------SAGEGYFRISAFN--SRANVEEVCRRIAAL............... 410
24 -20.0001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  14  11.........................................AKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSEHPKLVYISTQYTKQ----ELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPIL--ENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVASTA.......... 359
25 -19.9003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  14  22............................................................PRNVGVLTEALQNIDDNLESD--IYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADENRRVAYHPLSHLEIHEQKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEKICHEQGISLHLDGARLWEITPFYQKSAEE---ICALFDSVYVSFYKGIGGAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFE---KRIGKMAEYFEAAKGLAERFNSCGVKTVPEVPVSNMFHVYFENSADEIGLTKIQDETGVGISGYLQEKS-ADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL........... 359
26 -19.9003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  13  27.....................................RLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQEN-AFFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--LPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLG--KREDILAACERLQMAPALQS.......... 394
27 -19.9003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  14  14......................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQKELHPIETILVGAADRLMTLDEIKALPDIACLLLELP---EIGGVAPAFSELETICRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYE---LRKDRMGQYYEQAKQLAEQFNALGVHTTPEVPVSNMFHLHFDGQAADISLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL........... 352
28 -19.8001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  14  25...........................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAY-YHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAV--FLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDIR....... 435
29 -19.7004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  16  32...........................................AVPVRLNTNE---HPPTRALVDDVVRSVRE-----AAIDLHRYPDRDAVALRADLAGYLTAQTGIWAANGSNEILQQLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRAN--DVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYG-----SSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGYLIATPAVIDAMLLVRLPY----HLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDAN-----VLFGEFADAPAAWRRYLEAGILIRDVGIPGY------LRATTG---LAEENDAFLRASARIATDLVPVTRSPVGAP 381
30 -19.6003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  17  24.........................................DIASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG-----RIAGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAESNALELVRRHENV-----VVTRTLSKSYSLAGGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATP---PDRDGKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE............. 353
31 -19.5003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  16  27...........................................NVDIRLNTNE---YPPSEALVADLVATVDKIATELN---------RDAVELRDELAAYITKQTGLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGA--DMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYA-----SPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGYFVANPAFIDAVMLVRLPY----HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESN-----VFFGDFSDQHAAWQAFLDRGVLIRDVGIAGH------LRTTIG---VPEENDAFLDAAAEIIKL............ 364
32 -19.5004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  17  21..................................................MRESIKLIASENITSLAVREAHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPDADAMVKKILEEKP---KLILFGG--SLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEC-KEKEMEEIAEFMKRIAIDKEKPEKVREDVK 404
33 -19.5004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  15  23...........................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKAYGLAGGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQAN-----VWLPLGSRTQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSD............ 353
34 -19.5003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  39.........RNENFGKLRAGYLFPEIARRRKAH----QEKNPDAKIISLGIGD--TEPLPKYIADAMAKAAAGLATREGYSGYEQGQGALREAVASTFYGHAGRADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHKRTDIIFFCSPNNPTGAAATLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGGWTVVPKALKYANGEPVHADWCFNGASNIVQAGGLACLQ-LKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDV-FAEILERCNIVTTP------PAGEGFVRASAFG--SRENILEAVRRFKEAYGKRN.......... 441
35 -19.5001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  18  22..................................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLHRP---KLIVAAA--SAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAV-GLEEMDEIAAIIGLVLKN............ 386
36 -19.4003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  14  16...........................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDIEGLKAAVAAYSG--PSIVYLVNPNNPTGTITPADVIEPWIAS-NTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGN-----VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI......... 354
37 -19.3006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  16  48.........................................SGAYLTDPDGRRWIDFDGDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHGYHCDEPFTPNQHGIVEFLFDLDVLAEWLSRPEQ---AAVVISPDHMHLGE---YTEFTRLTKEADVPVIADEV----KVGLRYRAGLSTPLLDPAV-----IVAKCLA--NGSVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATG-EPQQAIRAAGDRFIAHTRAAFANAGVLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAAL........... 388
38 -19.2006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  13  29.........................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPER---AAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASLIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL........... 371
39 -19.1001v72_A mol:protein length:356 Aldolase  ali model follow..  14  5.........................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHINNDECEFFSNGAKLMTVDGDIVRLRERTREKVGDVHTVSITQAIYTLD----EIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAE-MTWKAGVDALSFGATKNGVLAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLT-DDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSA-----MIDALLKAGFGF------HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ.......... 354
40 -18.9003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  16  38.........................................QRDTLEMIASENFVP----RAVLQAQGSVLNKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEFRP---KVIIAGW--SAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKAGVSTDVHLVLVDLRDSPDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAL-GDTEFTEVADIIATALAT............ 407
41 -18.9006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  13  45.........................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPER---AAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASLIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL........... 387
42 -18.8002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  12  1...MGSSSSGLVPRGSHMISNKLANIPDSYFGKTMGRKIEHGPLPLINMAVGI--DGPTPQGIIDHFQKALTIPENQKYGA--FHGKEAFKQAIVDFYQRQYNVTEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVA-IEIYSLSKGYNMSGGFAVGNKDMIQALK-KYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPGYDSEQFEQFLVQEKSILVAP------ENGNRYVRISLAL--DDQKLDEAAIRLTELAYLYE.......... 398
43 -18.8002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  15  26.........RNSNMSKLQAGYLFPEI----ARRRSAHLLKYPDAQVISLGIGD--TEPIPEVITSAMAKKAHELSTIEGYSGYEQGAKPLRAAIAKTFYGGLGIGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENRTDIIFFCSPNNPTGAAATLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVA-METASFSKYAGFTGGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDV-FAEILEKTHVVTTP------PGGEGFVRVSAFG--HRENILEACRRFKQLYK............. 426
44 -18.7004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  19  30..................................................QEDHIELIASENYTSPAVMAANKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGAHGGHLTHGSPVNMSGKWFNVVSYGDYDAAEKLANEHKP---KLIVAGA--SAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAG-----VYPNPVPHADFVTTTTHKSLGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAM-GPAEAEQVGNLIADVLEN............ 393
45 -18.7002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  14  18....................................RKARERGVGLIDLSIGS--DLPPPEAPLKALAEALND--PTTYGYCLKSCTLPFLEEAARWYEGRYGVGEALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADKAVPEGVWREAKVLLLNYPNNPTGAVADFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERV-VELFSLSKSYNLAGGFALGSEEALARLERVKGVI--DFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWG--LPEGVDDLEFGLRLVERGVALAP------PGGKGFVRIALVR--PLEELLEAAKRIREALD............. 376
46 -18.7006MME Entity 1(prereleased)  ali follow..  14  25...........................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGSMANMRAVRELTEAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAV--FLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYE 442
47 -18.6003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  17  29.........................................QEEHIELIASENYTS----PRVMQAQGSQLNKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGAQGGHLTHGSPVNFSGKLYNIVPYGDYDEMAKLAKEHKP---KMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEKVYQQQVAKNAKAMVEVFLNRGYKVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAV-KEAEVKELAGWMCDVLDN............ 395
48 -18.6003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  13  30...........................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNLDEKKLYETHKDEIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLYGLGGGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFF---DEKNSTDLSEKLLKKGIIIRNLKSYGLN-----IRITIG---TSYENEKFFTEFDKILR............. 365
49 -18.6003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  16  25..................................................QNSNIELIASENFVSEAVMEANKYAEGYPGRRYYGGCEVTESIAIDRAKALFGAEHVNV--SGPQANMAVYLVALEMGDTVLGSHGGHLTHGAPVNFSGKFYNFVEYGNYDEVRKLALEHKP---KLIVAGA--SAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAG-----LHPNPVEYADFVTTTTHKTLGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNKTYQQQVVKNAKVLAEALINEGFRIGGTDNHLVAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKTSGIRLGTPAA-DEKAFEEVAKIISLALKN............ 390
50 -18.5005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  14  4............................................KSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHVETDECEFFSNGSKLLTAASTPQSIREVALKRQDYPKPRVVTITQATEVGTVYRLKAISATCKELGLNLHMDGARFTNACAFLGCSPAE-LTWKAGVDVLCFGGTKNGMAGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE------RHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT............. 345
51 -18.4001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  17  9...........................................HQFPGLANKTYFNFGGQGILPTVALEAITAMENGPFSIAANQHIQQLIAQLRQALAETFNVDPTITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIFGITYRFFPV---ATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGRVLVDGAQSAGSLPLDFSRL--------EVDYYAFTGHKWFGPAGGGLYIHGDCLGEIAEGGKRFEVATSAYPQYAGAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLP--LATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDC------IRACCHYITDEEEINHLLARLADFG.............. 389
52 -18.4004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  13  40.........RNVNLEKLKNNYLFPEI----NRRELEHIEKHPNVQLISLGTGD--TEPIPEQITSHMSNFAHGLSTVEGYRGYEQGNKTLRKAIAETFYRDLHVKNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKGPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVA-IEVSSFSKFAGFTGGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSSGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGSKSWDV-FNEILENTHIITVP------PGGEEYLRISGFG--RRDHIVEASKRLQNFFNTRTKHFTYLSS.. 451
53 -18.3001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  16  1......MRGLSRRVQAMKPSATVAVNAKALE-------LRRQGVDLVALTAGE--DFDTPEHVKEAARRALAQ---GKTKYAPPAGIPELREALAEKFRRENGPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVERVRRAITPRTKALVVNSPNNPTGAVEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGR---VAPEHTLTVNGAAKAFAMTGGYACGPKEVIKAMASVSSQS--TTSPDTIAQWATLEALTNQEASEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGV---AVVPGTDFAAFGHVRLSYAT--SEENLRKALERFARVLGR............ 384
54 -18.2006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  11  1..MGSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQ---SASQQSIVSRLPQLWYE-----------GLQATYEKRFTEAFFQLHRQNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDIYPELERRVRTDALFLVDPNNPTGFSLLFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYELLENSGLAIEDTGKTWPVQDALITASDDIWETVYNLHTSVLLNV--SPFVLNMLTQYVRDSAADASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFRVDHPELTATVHRLLSADGVYVLPFYWSEPSKGDAYVRMALAR--EPEMFADAMALTRQVLDRHG.......... 406
55 -18.2001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  15  24.........................................GMKDVISLGIGE--DFDTPQHIKEYAKEALDK---GLTHYGPNIGLLELREAIAEKLKKQNGIEEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRDELKKYVTDKTRALIINSPCNPTGAVKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGGFVAAPSWIIERMKFQMYNATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYAT--AYEKLEEAMDRMERVLKERKLV........ 389
56 -18.1003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  17  31..................................................QQSQVELIASENIVSRAVLDANKYAEGYPGKRYYGGCEEVEALAIERVKRLFNAGHANV--SGAQANGAVMLALAKPGDTVLGDAGGHLTHGAKPALSGKWFNALQYGDYDQVEALAQQHKP---SLIIAGF--SAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLGPRGGFVLTNEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKTSGIRLGTPAG-GAAEFREVGRLILEVFEA............ 396
57 -18.0003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  16  16............................VMDVMEAARRAEEAGRRIIHMEVGQ--GTGAPRGAVEALAKSLET---DALGYTVALGLPALRQRIARLYGEWYGVGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADFAGLDLAGLMVASPANPTGTMAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALE----LTDECYVINSFSKYFSMTGGWMVVPEDQVRVVERIAQNMF--ICAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAFTRIAPPDGAFYVYADVSDLTDDSRAFAAEILEKGVAVTPGLDFDPERGAGTLRFSYAR--ATADIEEGLDRLEAFMQARG.......... 383
58 -18.0002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  17  31.....................................AARRRGEDIIDLSMGN--DGPTPPHIVEKLCTVAQR---DTHGYSTSRGIPRLRRAISHWYRDRYDVQEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVEFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGGFMVGNPELVSALA-RIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVIPEPYAHLGSLEFAKKLLQDAKVSVSP------DYGDDHVRFALIE--NRDRLRQAVRGIKAMFRADGLLSPQRKV.. 407
59 -18.0004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  16  59.........................................GGCLLRDVEDGEIIDLNADREVLDAVADQFAK-GHMTGLP------HELDARAGALIAELVPGVEQVRFNSGTEAVASALRATTGRTLVVTFEGHYHGW-SETVLRAGAHTVQLGWNDPDALRELFARDGDRIAAVIV-EPVLANAGVIPPLQLLRELTGRSGAMLVFDEV--TGFRVARG-GAQERYGVEPDL----TVLSKVMG--GGFFGGRRHAMRMLASNEAHHAGVYAGNHAALRAVVAMLGKIRSLPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMLVDFPRHRRLQTLAQKEGVYFHP---------NALEPWFLSTAHTRDVIDKVAGALQRSLVGLG.......... 458
60 -18.0003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  1........................................MGSDKIENLYFQGMLNFTVGPMSSEEVRAIGAEQVPYFRTTEFSSTMLENEKFMLEYAKAPEGSKAVFMTCSSTGSMEAVVMNCFTKKDKVLVHRFVQLCEIHEIPYVALKLEHGKKLTKEKLYEYDNQN-----TGLLVNVDETSTAVLYDTMMIGEFCKKNNMFFVCDCVSAFL---------ADPFNMNEGADVMITGSQKVLACPPGVIVLAPRGVERVEKSKVRTMYPFTPAVGILLQINERLKEIKKHDAEVARIASQAADFRAKIKDLPFELVSESPANGVTSVHPTTANAYDIFLKLKDEYGIWICP------EMKDTIFRVGHIGALTHEDNTTLVNAFKDLQKRNLL......... 370
61 -18.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  16  26..................................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEIVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLEPGDTVLGAHGGHLTHGSPVNFSGKLYNIVPYGDYADLEKQAKEHKP---KMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEKTYQQQVAKNAKAMVEVFLERGYKVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRVGTPAI-KEAEAKELAGWMCDVLDS............ 392
62 -17.9003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  15  16...........................................AQAVCLAFNE---EAVEPRVQAAIAAAAARINRYPFDAE---------PRVMRKLAEHFSCPDNLMLVRGIDECFDRISAEFSSMRFVTAWGYRARIAVSGLRHFEIGLTDDLLLDPNDL------AQVSRDDCVVLANPSNPTGQALSAGELDQLRQR--GKLLIDETY-VDYSSFRARGLAYGENE-----LVFRSFSKSYGLAGGALFGPSELIAAMKRKQWFC----NVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEAN-----FVLVENAAGERTLRFLRERGIQVKDAGQFGLHH----IRISIG---REEDNDRLLAALAEYSDH............ 336
63 -17.8004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  15  26..................................................QSSVIELIASENFVSPAVLEANKYAEGYPSKRFYNGCEKAENLAIERVKKLFNCKYANV--SGSQANQAVYLALLQPGDTVLGDSGGHLTHGAAPNMSGKWFNAVSYSDYDEIERLADLHKP---KLLIAGF--SAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATG-----EHQSPIPYAHAVTSTTHKTLGPRGGLISNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKGITGKLAANSLDRAGITCNKNAIPFDETSTSGIRLGTPAC-KEKDFVLVGHMVADILDGLKNNEDNSALEQ 403
64 -17.8003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  15  46................................AKAANNSKNQGRELINLGQGF--SYSPPQFAIKEAQKALDIPMVNQYSP--TRGRPSLINSLIKLYSPIYNTENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVEELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGGWVLSLNAELLSYAAKAHTRICFASPSPLQEACANSINDALKIGEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKNKGKDFRISHWLINEGVVAIP-IKEHEKAAENLLRFAVCK--DDAYLENAVERLKLLKDYL........... 447
65 -17.8001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  16  3.....................LHPRTEAAKESIFPRMSGLAQRLGAVNLGQGF--SNPPPPFLLEAVRRALG----RQDQYAPPAGLPALREALAEEFA--VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVRELEAIARLARAHDLFLISDEVYDELYYGERPRRLRE---FAPERTFTVGSAGKRLEATGGWIVGPKEFMPRLAGMRQWTSFSA--PTPLQAGVAEALKLARREGALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPGWDAFRL-----VEEARVLIPASAFYLEDPPKDLFRFAFCK--TEEELHLALERLGRVVNSPREAEGGAVSG. 381
66 -17.8005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  10  1............................MTTQPQLKENLTQWAYLALNSELN---DGHARQALSPGQQKIVNE--AESEQRPVQQIESEAHQAYFTLLGQHAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGAD--LSAELLSSVGCVFVTTPNNPTGRVLALRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLQEAGCRW-VVIEDTGKLWPTLDGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSRDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVERVAFAGRTGTEVWEELQRHHVFALPFHWAEPSDGDHMVRIALSR--STEPLEKSVQVLRTVLET............ 375
67 -17.7003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  17  24..................................................QCEGLEMIASENFTLPEVMEVNKYAEGYPGKRYYGGCEEIETLAIERCKKLFNCKFANV--SGSQANQGVYAALINPGDKILGSHGGHLTHGAKVSSSGKMYESCFYGVELDYEKVREIAKKEKPKLIVCGA--SAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAG------HPSPFPYAHVVSSTTHKTLGPRGGIITNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEKVYAKQVRTNAQVLANVLMDRKFKLSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSTSGLRLGTPAL-KEKEMEIVSNYIADILDD............ 388
68 -17.7002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  15  22..................................................QREGLELIASENFVSKQVREANKYAEGYPGARYYGGCERVESLAIERAKALFGAAWANV--SGSQANMAVYMALMEPGDTLMGAAGGHLTHGSRVNFSGKLYKVVSYGDLEEVRRLALEHRP---KVIVAGA--SAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLGPRGGLISNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEKEYSRLVVENAKRLAEELARRGYRITGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPTSGIRIGTPAI-TPEEMPLVAELIDRALLEGPSEALREEVRR 399
69 -17.7005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  17  25..................................................QNEHLEMIASENYTFPSVMEANKYAEGYPNKRYYGGCEKIESLAIERAKKLFNCQFANV--SGSQANNAVYHALLKPYDKILGSCGGHLTHGAKVSLTGKHYQSFSYGDYEEALKIAQSVKP---EIIVCGF--SAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTN-----EHAHPFPHCHVVSSTTHKTLGPRGGIILTNEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEKAYAKLVKSNMQVLAKALKEKNHKLSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSTSGIRIGSAAL-GAKEFEIIGNKISDILND............ 389
70 -17.6001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  13  4..........TSNETMHNKFDLPKRYQGSTKSVWVEYIQLAAQYKPLNLGQ-GFPDYHAPKYALNALAAAANSPDPLANQYTRGFGHPRLVQALSKLYSQLVDRTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGGWAYGPEALLKNLQMVHQNCVYTCATP-AIAVGFETELKRLKSPESISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSDARKDYRFTKWMTKSGLQGIP-SEPNKHLGEDFVRYCFFK--KDENLQKAAEILRKWKGS............ 428
71 -17.5002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  15  14............................VMDILALAQKLESEGKKVIHLEIGE--DFNTPKPIVDEGIKSLKE---GKTHYTDSRGILELREKISELYKDKYKPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD--TVESLEEALSD----KTKAIIINSPSNPLGEVID-REIYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFDENLEKT-ILINGFSKLYAMTGGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETEREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNI---GEDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYAN--SYENIKEGLERIKEFLNK............ 370
72 -17.5002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  20  42.........................................EGAYVWDADGNRYLDYVAHPKVLARVRETLER-------GLTFGAPSPLEVALAKKVKRAYPFVDLVRFNSGTEATMSALRGYTGRPYIVKFRGNYHGH-ADGLLVEAGSTLVLEYNDPEGLREVLKRRGEEIAAIIF-EPVVGNAGVLVPTEDFLKEAKAYGVLLIADEV--TGFRLAFG-GATELLGLKPDL----VTLGKILG--GGLYAGRREIMEKVAPLGPVYQAGTSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMI-TDTELFKRFFHGLLDRGIYWPP---------SNFEAAFLSVAHREEDVEKTLEALRKA............... 423
73 -17.5004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  12  1................MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQ-GFPDFPPPDFAVEAFQHAVSG-DFMLNQYTKTFGYPPLTKILASFFGELLGQENVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVEELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGGWVLGPDHIMKHLRTVHQNSVFHCPTQ-AVAESFEREQLLFRQPSSFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDDEPYDRRFVKWMIKNGLVAIP-SVPHQKHFDHYIRFCFVK--DEATLQAMDEKLRKWKVELENLYFQGKGGR 433
74 -17.5001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  14  2...............TNNPLIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGF--DFDGPRYLQERLAHHVAQ---GANQYAPMTGVQALREAIAQKTERLYGYQDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMAPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGGYCVAPAPISAEIR-KVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSASTLDDVEFCQWLTQEHAAIPLSVFCADPFPHKLIRLCFAK--KESTLLAAAERLRQL............... 386
75 -17.5003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  12  21.........................................PKKRGLDLGIGE--QFETPKFIQDALKNHTH----SLNIYPKSAFEESLRAAQRGFFKRRFKIENELISTLGSREVLFNFPSFVYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPSLNEKELQEVDLVILNSPNNPTGRTLSLISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMLAGN--LVIHSLSKRSSAPGGFIAGDSRLLEKYKAFRAYL--GYTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNTLIYPYSF--------VYLPVQNGENFAKTLYQNEGIITLPLYLGRNRIGADYVRLALVY--DTPLLEKPLEIIETYRENHA.......... 376

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24