current user: public

If you have questions about the server, please let us know.

Query: 2xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MSSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNPLast
1 -75.6002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model  100  1MSSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNP 133
2 -69.9004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  39  18.PTPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH.... 145
3 -67.5005v3t_A mol:protein length:132 Globin  ali model follow..  37  1MSKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFP---DDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNET. 129
4 -65.3005d1v_A mol:protein length:127 Globin  ali model follow..  34  2...SEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFP---ADLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGED. 127
5 -65.1002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  39  2......TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYP--EEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE... 123
6 -63.7002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  40  1..EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFP---DDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHL. 127
7 -61.9001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  32  2....PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYP--EDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP.... 127
8 -61.5004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  35  30.HDDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFP--EEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDA. 158
9 -61.0001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  38  1MGQSFNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFP---SDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAED 129
10 -60.8004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  19  4.TAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFA--NVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAGA 133
11 -58.5002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  16  9.KREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFS--GTNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTT. 133
12 -58.4001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  16  9.KREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFS--GTNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTT. 133
13 -58.1003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  19  1MNKPQ-TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFK--NTDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK..... 121
14 -57.8006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  16  1.....STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFR--GVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKG. 125
15 -56.9004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  21  47.VKFPSKKVYLAAGEELLRKLVEVHHENLMKSK-IHYLFPTSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRTTL. 176
16 -56.8004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  19  20FAIDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAGNELKN 152
17 -56.8002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  17  1.....ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFV--NTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHDVLNR..... 123
18 -56.4001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  24  1......SLFEQLGGQAAVQAVTAQFYANIQADATVATFFN--GIDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT...... 115
19 -55.8001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  19  2.....STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFA--DVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ..... 124
20 -55.8001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  15  39.RKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFS--NTDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ.. 164
21 -46.0002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  16  1.......MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNTSDEEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIV-YNEEMKNVILQRAQMIASHFQNMLYKYG 125
22 -16.6005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  11  18WGDGDERALRSLHGAPHFPRLAEEFYDRILGHEGARTALVGGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV............ 145
23 -15.8002w31_A mol:protein length:162 GLOBIN  ali model follow..  13  13FTDEDAELLGSLFPETNKERLADQFYDYLLGIPETAEFLKEDLV-LQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI............ 138
24 -15.6001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  10  43LGDAELYVLEQLQPQENIVNIVDAFYKNLDHESSLMDIINDHSS-VDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI............ 168
25 -15.0004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  10  16VEQADPPIRAKAAEVAHAHYLSIEFYRIVRIDPHAEEFLSNEQV-ERQLKSAMERWIINVLSAQVDDVERLIQITVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSID...... 145
26 -14.5004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  11VEQADPPIRAKAAEVAHAHYLSIEFYRIVRIDPHAEEFLSNEQV-ERQLKSAMERWIINVLSAQVDDVERLIQITVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS............ 138
27 -14.5004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  58LGQFPAPVVAQIRETTHQSELPGYFYEQMLQDEQAMLFLTHEQV-KSRLHGTLRQWIVSVFSMSQALIAQ--QKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET............ 187
28 -14.4001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  12  3MNAADMQSYGRCCAST---GFFDDFYRHFASSPQIRAKFA--TTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYGS.. 134
29 -14.3002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  10  1MTKEQIQIIKDC--QKNGEDLTNEFYKIMNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLEN----DKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEKK.. 136
30 -13.8002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  34FTAEDEEYIQKAGEEDQVEEILDTWYGFVGSHPHLLYYFTSPEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA............ 177
31 -13.7004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  16  16SAHYSPHEWVAARNTANKAALADYFYESMLADPNAAFFLSDQLV-KTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV............ 145
32 -13.6001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  12  2LDQQTINIIKAT--KEHGVTITTTFYKNLAKHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPA----KKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVEAD.. 139
33 -13.1003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  13  1MTREEIKMIQKS--IDKMDEAGLLFYRRLDVEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDAALDA---RELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE..... 132
34 -12.7001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  11  3FTEKQDALVSSS--KANIPQYSVVFYTSIEKAPAAKDLFSFTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK...... 142
35 -12.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  10  2IDQKEKELIKES--EPNKNEIGLLFYANLKEEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNLEGLIPT---QDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE..... 133
36 -12.3001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  3LSEDQEHYIKGVWKDVDHKQITAKALERVVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKQNLSGKHQEIGVDTQNFKLLGQTFMVELALHTFRPKEHAAAYKFFRLVAEALSSN..... 139
37 -11.4001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  15  3LTESQAALVKSS--NANIPKHTHRFFILVEIAPAAKDLFSFNNPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMDDA. 152
38 -11.0001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  12  2LSAAQRQVWKDIAGADNGAGVGKECLSKFSAHPEMAAVFGFSGASDPGVAELGAKVLAQIGVAVSHLGDEGK-KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQS.. 147
39 -10.8001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  11  2LSAAQRQVWKDIAGSDNGAGVGKECFTKFSAHHDMAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGK-KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS.. 147
40 -10.5001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  12  2LSAAQRQVWKDIAGADNGAGVGKKCLIKFSAHPQMAAVFGFSGASDPGVAALGAKVLAQIGVAVSHLGDEGK-KAVGVRHKGYGIKAQYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS.. 147
41 -10.0001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  10  13LTPAEKDLIRST--MTHRTGFVADVFIRIHNDPTAQRKFPQTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEGFTKQVHDAWAKTFAIVQGVLITKHAS.. 159
42 -10.0001eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  1LSADQISTVQAS---DKVKGDPVGILYAVKADPSIMAKFTQGTAPFETHANRIVGFFSKIIGELPNIEAD---NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK..... 135
43 -9.9201oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  1MERPEPELIRQS--SRSPLEHGTVLFARLALEPDLLPLFQLSSPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKSAFTPATRAAWSQLYGAVVQAMSRGWDGE. 151
44 -9.8904mpm_A mol:protein length:151 Neuroglobin  ali model follow..  1MERPEPELIRQS--SRSPLEHGTVLFARLALEPDLLPLFQLSSPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCAFTPATRAAWSQLYGAVVQAMSRGWDGE. 151
45 -9.8701gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  10  3WTQEERDEISKTFQGTDMKTVVTQALDRMKVYPWTNRYFQRTDFRSSIHAGIVVGALQDAVKHMDDVKTL---KDLSKKHADLHVDPGSFHLLTDCIIVELAYLCFTPHIQGIWDKFFEVVIDAISKQ..... 134
46 -9.7902r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  11  13FGEEQEALVLKS--KKDAANLGLRFFLKVEIAPSAKQMFSFKNPKLKTHAMSVFVMTCEAAAQGKVTVRETTLKRLGATHLRYGVADGHFEALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPD. 164
47 -9.7601d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  12  14FSEEQEALVLKS--KKDSANIALRFFLKIEVAPSASQMFSFLRNSDVPLEKNTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPA. 165
48 -9.7503mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  11  3WTQEERDEIVKTFFSANSSAIGTKALERMVVFPWTNAYFAXXXFSASIHAAIVVGALQDAVKHEDDVKAE---VNISKAHAKLHIDPGSFHLLTDSFIVELAHLAFTPFVFAVWIKFFQVVIDAISSQ..... 134
49 -9.7303qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  10FTEEQEALVVKS--KKNSAELGLKFFLKIEIAPSAKNLFSYQNPKLKPHAMTVFVMTCESAVQLRKAGK----KRLGAIHFKNGVVNEHFEVTRFALLETIKEAMWSPEMKNAWGEAYDQLVAAIKSEMKPS. 160
50 -9.7002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  12  10FSEEKEALVLKS--KKDSANLGLRFFLKIEIAPSARQMFPFLRDSDVPLETNTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHFEALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPA. 161
51 -9.5702vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  4MERPESELIRQS--SRSPLEHGTVLFARLALEPSLLPLFQLSSPEFLDHIRKVMLVIDAAVTNVEDLSS----TSLGRKHRAVGVRLSSFSTVGESLLYMLEKSDFTPATRTAWSRLYGAVVQAMSRGWDGE. 154
52 -9.5504b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  9VSEEQQSLIMED--LPNYDDFVEDVLQQFEENPETFQIFPWSHPRFKSHAKSIGKVISDCLVDLNGVKK----SSLGAMHTKKKVPTELFGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE...... 154
53 -9.5002r4x_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGVSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
54 -9.4801hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  13LTLAQKKIVRKT--MRNKTSFVTDVFIRIAYDPSAQNKFPQSSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAEDFNEKTRDAWAKAFSVVQAVLLVKHG... 158
55 -9.4703zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  9FTEEQEALVVKS--KKNSAELGLKLFIKIEIAPTTKKMFSFQNPKLKPHAMSVFVMCCESAVQLRKTGK----KRLGASHSKYGVVDEHFEVAKYALLETIKEAMWSPEMKVAWGQAYDHLVAAIKAEMNLS. 159
56 -9.4202bk9_A mol:protein length:153 CG9734-PA  ali model follow..  1MNSDEVQLIKKT--VATPTDSGAAILTQFNRFPSNLEKFPFGNARFRAHAGRIIRVFDESIQVLGQDGDLEK-TKIAVSHIPRTVSKESYNQLKGVILDVLTASSLDESQAATWAKLVDHVYAIIFKAIDDD. 149
57 -9.4003uhc_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQAFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
58 -9.3603uhb_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
59 -9.3503uhd_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
60 -9.3503ugz_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVAAMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
61 -9.3303ugy_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNYIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
62 -9.3103at5_B mol:protein length:146 Beta-globin  ali model follow..  3FTQEERQFIVNLWGRVDVEQIGAEALARLIVYPWTQRFFSSHNAKVHAHGKKVLTSFGEAVKN----IKQTFAQLSELHSDKLHVDPENFKLLGNILIIVLAAHDFTPASQAAWQKLVSAVAHALALR..... 144
63 -9.2902auo_A mol:protein length:146 Globin I  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKMANDKLRGHSITLMYALQNFIDQLDNPDD----EKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
64 -9.2903uhi_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----ERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
65 -9.2903uh6_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSIALMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
66 -9.2802grf_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALVTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
67 -9.2702r4z_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
68 -9.2701kr7_A mol:protein length:110 Neural globin  ali model follow..  16  2...............VNWAAVVDDFYQELKAHPEYQNKFGFKGVALGSLKGAYKTQAGKTVDYINAAIGGSADAGLASRHKGRNVGSAEFHNAKACLAKACSAH-GAPDLGHAIDDILSHL............ 110
69 -9.2401hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL........ 146
70 -9.1604g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  11  2LAEKTRSIIKAT--EQQGTVITRTFYKNMTEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDDLSV----KQIGHKHRALQIKPEHYPIVGEYLLKAIKEVAATPEIINAWGEAYQAIADIFITVEKKM. 140
71 -9.1103qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  10FTEEQEALVVKA--KKNSAELGLQFFLKIEIAPSAKNLFSYQNPKLKPHATTVFVMTCESAVQGKVTVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAMWSPEMKNAWGVAYDQLVAAIKFEMKPS. 160
72 -9.0503pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  4LTGPQKAALKSS--MNNAVTNGTNFYMDLKAYPDTLTPFKSNHPTMKAQSLVFCNGMSSFVDNLDDHEV----QKMAKLHFNRGIRIKELRDGYGVLLRYLEDCHVEGSTKNAWEDFIAYICRVQGDFMKER. 151

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.