current user: public

If you have questions about the server, please let us know.

Query: 2zy2_A mol:protein length:544 L-aspartate 4-carboxylyase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .
# Score Template Links and tools%idFirst MSKDYRSLANLSPFELKDELIKVASGKANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKLDGIEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQRPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGKEKLAAALELast
1 -148.0002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model  100  1MSKDYRSLANLSPFELKDELIKVASGKANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKLDGIEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQRPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALGKEKLAAALE 538
2 -129.0002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  85  1MSKDYQSLAKLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSGQAQNKLAAALE 540
3 -126.0003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  84  1MSKDYQSLANLSPFELKDELIKIASGDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTVGVGGLAKIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHRPDLMILTDDVYGTFADGFQSLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLVADSRAVALNHTAGLSTPQQVQMTLFSLFALMDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDVTSKLYGEAFSKWAVKQSSTGDMLFRIADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRQMADELYAQYTQQGNKR...... 533
4 -118.0003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  39  4.NSEEKKLEALGAFEISRKMLALAQKNKSNIFLNAGRGNPNWIQTLARLAFVRLVQFGVTESKLTINN--GIMAGYINTDGIRERL-FAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANNYPVPDRCLVNTEKIINYFLQELSYKDANLAEQTDLFPTEGGTAAIVYAFHSLAENHLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHSYEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKN-PKLMIISDEVYGAFVPNFKSIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDPDKMKFIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLGSDDPYIDIARKLVSERYDQLHDAMQAPKDETDTNTHYYSLIDIYRLAEKIYGKEFRDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAKPGELRVSQANLPTEDYALIGKQVLELLKEYYEEFKQNN......... 533
5 -77.7001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  16  1...................................................................MKLAARVESVSPSM------TLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALETRYGPAAGEPRLREAIAQKLQRDN----GLCYGADNILVTNGGKQSIFNLM-----LAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPT--TVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEA--GLWVLSDEIYEKILYDDAQHLSIAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDG----------------------------------------------AFYMFPSIAKT---------------GRSSLDFCSELLDQHQVATVPGAAFGA-DDCIRLSYATDLDTIKRGMERLEKFLHGIL................. 388
6 -76.9005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  18  60.........................................................DAETLSSSVDMSLSPRVQSLKPSK------TMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIRTRYTLNAGITELREAICRKLKEEN----GLSYAPDQILVSNGAKQSLLQAV-----LAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPT--KISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKH-PRLLVLSDEIYEHIIYAPATHTSFMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQG----------------------------------------------AFYLFIDFSAYYGSEAEGF-----GLINDSSSLALYFLDKFQVAMVPGDAFGD-DSCIRISYATSLDVLQAAVEKIRKALEP................... 468
7 -75.9001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  17  3................................................................SDKIMVSRRISEIPISK------TMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQVKYTDPRGIYELREGIAKRIGERY----KKDISPDQVVVTNGAKQALFNAF-----MALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETF--MSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKR--NFYIISDEVYDSLVYTDEFTVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAALKALEVDNSYMVQTFKERKNFVVERLKKM-GVKFVEPEG----------------------------------------------AFYLFFKVRG------------------DDVKFCERLLEEKKVALVPGSAFLK-PGFVRLSFATSIERLTEALDRIEDFLNSR.................. 383
8 -75.5001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  19  4.....................................................................LSRRVQAMKPSA------TVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALATKYAPPAGIPELREALAEKFRREN----GLSVTPEETIVTVGGSQALFNLF-----QAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETL--PEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEH--DFYLVSDEIYEHLLYEGESPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTQWATLEALTNQEASVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSG----------------------------------------------AFYVLMDTSPI---------------APDEVRAAERLL-EAGVAVVPGTDFAA-FGHVRLSYATSEENLRKALERFARVLGR................... 384
9 -75.4003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  15  1..................................AGHMKQRFIRQFTNLM-------TSRPKVVANKYFTSNTAKDVWSL------TNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDNQYSPTRGRPSLINSLIKLYSPIY----NTELKAENVTVTTGANEGILS-----CLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKH--NVVIISDEVYEHLYFTDSTLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAELLSY--------------------------------------AAKAHTRICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKVKIPE-DYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKENLLRFAVCKDDAYLENAVERLKLLKDY................... 446
10 -74.7004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  15  3...............................................................MDLSKRFNKNLNKIEVSMIR----------QFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDSHYTGMAGLLALRQAASAFVKEKYHLTYNPD---NEILVTIGATEALS-----ASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTR---SNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKY--PIFVISDEVYAELTYTHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDG----------------------------------------------AFYIFAKIPVAQGQ--------------DSFKFLQDFAKEKAVAFIPGVAFGYGEGYLRISYAASMETIKEAMKRLKEFMEQ................... 390
11 -74.6005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  18  12...................................................................................PPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLGYSVALGIPELRDAIAADYQRRH----GITVEPDAVVITTGSSGGFL-----LAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPC--GPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDAS--DVRLISDEVYHGLVYQGASCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGPVLSQIAAVSAFTPEATAADGNLASYAINRSLLLDGLRRIGIDRLAPTDG----------------------------------------------AFYVYADVSDFTS---------------DSLAFCSKLLADTGVAIAPGIDFDTGGSFVRISFAGPSGDIEEALRRIGSWLPSQ.................. 388
12 -74.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  14  2...............................................................MSIEAKFKKLGTDNAPGQEVRQSAA--GLEALIRGAPIEGRPVDFSHGDVDAHTPGAFDLFSAGVQSQAYTEYRGDLGIRDLLAPRLAAFTGAPVD---ARDGLIITPGTQGALF-----LAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY--GATVIADQLYSRLRYAGASYTHLRAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQA----------------------------------------------GSYLFPRLPKL---------------AVAPAEFVKILRLQAGVVVTPGTEFSHTADSVRLNFSQDHEAAVAAARRIVTLVER................... 404
13 -74.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  20  1...................................................................MALSDRLELVSASEIRKLFDI----------AAGMKDVISLGIGEPDFDTPQHIKEYAKEALDTHYGPNIGLLELREAIAEKLKKQNGIEADPK---TEIMVLLGANQAFL-----MGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTY--EEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEH--DLIVISDEVYEHFIYDDARHYSIMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATQYAAAKALKDERSAVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKG----------------------------------------------AFYIFPRIRDT---------------GLTSKKFSELMLKEARVAVVPGSAFGAGEGYVRISYATAYEKLEEAMDRMERVLKE................... 385
14 -73.8002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  15  2.............................................................GSDKIMDVFSDRVLLTEESPIRK------LVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPVYYSHSAGIWELREAFASYYKRRQ----RVDVKPENVLVTNGGSEAIL-----FSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR--MEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERH--GLFLIVDEVYSEIVFRFASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSG----------------------------------------------AFYITAELP-----------------VEDAEEFARWMLTDFNTMVAPLRGFYLGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSSR.............. 400
15 -73.6001xi9_A mol:protein length:406 putative transaminase  ali model follow..  16  1................................................................AGSIRASKRALSVEYA-------IRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKNYYGDSEGLPELRKAIVEREKRKN----GVDITPDDVRVTAAVTEALQ-----LIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRT--IEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEY--EIPVISDEIYDLMTYEGEHISPGSDVPVIVMNGLSKVYFATGWRLGYMYFVDPERLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQG----------------------------------------------AFYIFPKIEVGPWK--------------NDKEFVLDVLHNAHVLFVHGSGFGYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLKE............... 400
16 -73.5003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  16  12...................................................................................DPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLELGYTVALGLPALRQRIARLYGEWY----GVDLDPGRVVITPGSSGGFL-----LAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPT--APENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQ--GASFISDEIYHGIEYEAKAVALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAAPHASQVAALAALDC-DAELQANLDVYKANRKLMLERLPKAGFTRIAPPDG----------------------------------------------AFYVYADVSDL---------------TDDSRAFAAEILEKAGVAVTPGLDFDRGAGTLRFSYARATADIEEGLDRLEAFMQA................... 381
17 -73.3004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  13  1............................................................................MAKQLQARRLDGIDYNPVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSNQYTKTFGYPPLTKILASFFGELLGQEID---PLRNVLVTVGGYGALFT-----AFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKLGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQH--DVVCITDEVYQWMVYDGHQHISIMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAE----------------------------------SFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLP----AVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVDHYIRFCFVKDEATLQAMDEKLRKWKVELENLYFQGKGGRADPAFL. 439
18 -72.1004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  12  14.........................................................NLYFEGAMSPIEKSSKLENVCYDIRGP------VLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLAQGYCDSKGLYSARKAIMQHYQARG----MRDVTVEDIYIGNGVSELIV-----QAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLC--DESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQH--NLIIFADEIYDKILYDDAEHHSIAPLLTITFNGLSKTYRVAGFRQGWMVLNGPKMLASMRLCANVPAQHAIQTALGGYQSEFITPGGRLYEQRNRAWELINDIPGVSCVKPRG----------------------------------------------ALYMFPKIDAKRFNI------------HDDQKMVLDFLLQEKVLLVQGTAFNPWPDHFRIVTLPRVDDIELSLSKFARFLSG................... 421
19 -71.5001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  13  3.........................................................STSNETMHNKFDLPKRYQGSTKSVWVEYIQ-----------LAAQYKPLNLGQGFPDYHAPKYALNALAAAANNQYTRGFGHPRLVQALSKLYSQLVDRTIN---PMTEVLVTVGAYEALYA-----TIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKW--NVLCVSDEVYEHMVFEPFEHIRIMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAV----------------------------------GFETELKRLKSPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSLDSKVDLTQ----ETDARKDYRFTKWMTKSVGLQGIPPSAFYSGEDFVRYCFFKKDENLQKAAEILRKWKGSS.................. 429
20 -71.4001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  20  3.................................................................................LHPRTEAAKESIPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGDQYAPPAGLPALREALAEEF----------AVEPESVVVTSGATEALY-----VLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDL-TPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAH--DLFLISDEVYDELYYGERRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSF---------------------------------------SAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG---------------------WDAFRLVEEARVALIPASAFYLEKDLFRFAFCKTEEELHLALERLGRVVNSPREAEGGAVSG........ 381
21 -71.3001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  17  2...........................................................................TNNPLIPQSKLPQLGTTITQMSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVANQYAPMTGVQALREAIAQKTERLYGYQPDAD---SDITVTAGATEALYA-----AITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ---PPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGH--EIFVISDEVYEHINFSQQGHASVLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEG----------------------------------------------TYFLLVDYSAVSTL--------------DDVEFCQWLTQEHGVAAIPLSVFCAPHKLIRLCFAKKESTLLAAAERLRQL...................... 386
22 -71.2002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  16  1....................................................................MLSKRLLNFESFEVMD------ILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKTHYTDSRGILELREKISELYKDKY----KADIIPDNIIITGGSSLGLF-----FALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF----------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYEN--IPYIISDEIYNGLVYEGKCYFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQPTISQYAALKAFEKETERINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIG----------------------------------------------AYYVFPNIGE------------------DGREFAYKLLKEKFVALTPGIGFGSGKNYIRISYANSYENIKEGLERIKEFLNK................... 370
23 -70.9002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  13  3..........................................................................AESRPARRFARIDRLITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQRGYSTSRGIPRLRRAISHWYRDRYDVQIDPE---SEAIVTIGSKEGLAHLM-----LATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLV--PGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQY--DVMVVHDLAYADIVYDGWKAPSIMKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKA----------------------------------------------SMYVWAKIPEPY-------------AHLGSLEFAKKLLQDAKVSVSPGIGFGDGDDHVRFALIENRDRLRQAVRGIKAMFRADGLLSPQRKVDSLAE.... 412
24 -70.7002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  14  2................................................................................ATVSRLRPYATTVAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIANQYPPGPGSAPLRRAIAAQRRRHFGVDYDPE---TEVLVTVGATEAIAA-----AVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVP-DGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAA--NLVVITDEVYEHLVFDHARHLPLMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYG----------------------------------------------TYFLCADPRPLGYD--------------DSTEFCAALPEKVGVAAIPMSAFCDPNHLVRFTFCKRDDTLDEAIRRLSVLAERP---------ATGVPRGLE 405
25 -70.6001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  12  17......................................................................................NPIRTVSDNAKPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKNGYFPTVGSPEAREAVATWWRNSHKEELKSTIVKDNVVLCSGGSHGIL-----MAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCR--PENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEEL--RLPLFSDEIYAGMVFKGKDPNATFTVPRVILGGTAKNLVVPGWRLGWLLYVDPHVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIK---------------------------------------------------------TDVEFFEKLLEEENVQVLPGTIFHA-PGFTRLTTTRPVEVYREAVERIKAFCQR................... 412
26 -70.2005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  13  1................................................................................ANAKRIEGLDSNVVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAA-NQYTRGFGHPALVKALSCLYGKIYQRQID---PNEEILVAVGAYGSLFN-----SIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKH--DTLCISDEVYEWLVYTGHTHVKIMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAE----------------------------------AFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMN-----SDEPYDYKFVKWMTKHKKLTAIPVSAFCDSEKLVRFCFIKKDSTLDAAEEIFRAW...................... 410
27 -69.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  14  4.........................................................SSSGLVPRGSHMISNKLANIPDSYFGKTMG--------RKIEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIKYGAFHGKEAFKQAIVDFYQRQYNVTLD---KEDEVCILYGTKNGLVAV-----PTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL---EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGT--DTKIVHDFAYGAFGFDAKNPSENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKG----------------------------------------------GIYVWLETP----------------PGYDSEQFEQFLVQEKSILVAPGKPFGEGNRYVRISLALDDQKLDEAAIRLTELAYL................... 396
28 -69.8003ele_A mol:protein length:398 Amino Transferase  ali model follow..  13  15..................................................................................RSAIRELFEYGKKRAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTHGYTSAQGDVETRAAIAEFLNNTH----GTHFNADNLYMTMGAAASLSICFRAL----TSDAYDEFITIAPYFPEYKVFVNAAGARLVEVPAD---TEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKSRPIFIIADEPYREIVYDGIKVPFVYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRSLFQKMIVKCQGATGDINAYKENRDLLYEGLTRI-GYHCFKPDG----------------------------------------------AFYMFVKAL-----------------EDDSNAFCEKAK-EEDVLIVAADGFGC-PGWVRISYCVDREMIKHSMPAFEKIYKK................... 395
29 -69.5004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  12  1..........................................MRGSGMASMTGGQQMGRDLYDDDDKDRWTSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRNGYPPTVGADNLRQVVSTYWRRFCQTKSR-ALKWENVIITSGVSQAIV-----LALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYL--DPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQH--QIPLISDEIYAEMVLNNGIFTSVADVPRLILGGTAKYQVCPGWRVGWSILIDPMLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQA----------------------------------------------SMFVMLKLN-----------LSYFQDLKSDMEFYEKLLDEENVQVLPGEIFGM-SGFLRATVSRPSAVLNEAVDRIIEFCERHKK................ 438
30 -69.2003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  16  9.........................................................TENLYFQSMWSVRPSDMAKKTFNPIRA------IVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDNGYAPSIGFLSSREEIASYYHCP-----EAPLEAKDVILTSGCSQAID-----LCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL--PEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQ--CVPILADEIYGDMVFSDCKYEPLADVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFE---------------------------------------------------------NDVEFTERLVAEQSVHCLPATCFEY-PNFIRVVITVPEVMMLEACSRIQEFCEQHYHC............... 421
31 -69.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  16  2...............................................................................SRVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDGYCLKSCTLPFLEEAARWYEGRYGVGLD---PRREALALIGSQEGLAHL-----LLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL----REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKH--GLWLIHDNPYVDQVYEGEAPLPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPR------------------------------------------------ATMYLWGRLP----------------EGVDDLEFGLRLV-ERGVALAPGRGFGGGKGFVRIALVRPLEELLEAAKRIREAL..................... 375
32 -68.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  6....................................RSTASGARSSTRSRRMTAVVQAVAQRAGTIDVQRNENFGKLRAGYL---FPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAASGYGAEQGQGALREAVASTFYGHA------GRAADEIFISDGSKCDIA------RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKN--GSILVYDAAYALYISNPDCPKTIYDEVAIETCSFSKYAGFTGVRLGWTVVPKALVMTTCFNGASNIVQAGGLACLQP-LKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDD----------------------------------------------APYIWVGFP-----------------GKPSWDVFAEILERCNIVTTPGSGYGAGEGFVRASAFGSRENILEAVRRFKEAYGK................... 439
33 -68.1004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  14  28.........................................................EMKKLGGSTKLVRNVNLEKLKNNYL---FPEINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHRGYGLEQGNKTLRKAIAETFYRDL------HVKSNEVFVSDGAQSDIS------RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPCGPPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTN--GSIIIFDSAYAAFIEDGSPRIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVN----------------------------------------------APYLWVHFK-----------------GSKSWDVFNEILENTHIITVPGSGFGGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTKHFTYLSSTSNT..... 455
34 -67.9003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  16  4.....................................................................RPSDMSNKTFNPIRA------IVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDNGYAPSIGYLSSREEVASYYHCP-----EAPLEAKDVILTSGCSQAIE-----LCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLL--PEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ--CVPILADEIYGDMVFSDCKYEPMANVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRPCTIVQGALKSILQTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFPEFE---------------------------------------------------------NDVEFTERLIAEQSVHCLPATCFEY-PNFFRVVITVPEVMMLEACSRIQEFCEQHY................. 402
35 -67.4003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  11  1......................................................GMNFPIDEKLIREKQNELHIKDLGMASIRDLVALVTNLEKAT-----GTKFCRMEMGVPGLPAPQIGIETEIQKLREIYPNLDGLPELKQEASRFAKLFV----NIDIPARACVPTVGSMQGCFVSFLVAN-RTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLF--EYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKH--DVIVIEDLAYFGMDFRKDPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESFGRLRFGEALSS--------------------SALYALSSGATHSAQWGMAAMLKACNDGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVYPLADGFYFTVGY----------------KGMDSSKLIEKFVRYGMCAITLKTTGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE................... 436
36 -66.8003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  16  14......AVDNLNPYAVRGEIVIHAQRLQEQLILYCNIGNPQSLGQQPVTFF------------------------------------------REVLALCDHPDLLQREEIKTLFSADSRAKQILAMIPGGAYSHSQGIHGLRDAIASGIASRD----GFPANADDIFLTDGASPGVHLMMQLL----IRNEKDGILVPIPQYPLYSASIALHGGAL--VPYYLNESTGWGLETSDVKKQLEINVRALVVINPGNPTGQVLAEENQYDIVKFCKNE--GLVLLADEVYQENIYVFHSFKKIVRPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEG----------------------------------------------AMYVFPQICLPQKAIEAAK----AANKAPDAFYALRLLESTGIVVVPGSGFGQGTWHFRCTILPQEDKIPAVISRFTVFH-EAFMSEYR............ 489
37 -66.6004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  15  4.........................................................SSSGLVPRGSHMSSLRPRREDPPVLEEWYRRHL--------GPDIHDISSSGVHPYSFAEIRDVCRIPAADLDADDSVSQGGEGVRRAIADRYA---------GGDADRVLVTHGSSEAIA-----LTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGR--AVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAAT--GAVLVWDAATAEIAHRWEVLADPDGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEEL------------------------------------------------TPPEGGVCALPVFRELERAAAG---------PQEVERFCLELLERHRTLLVPGTAFGA-PHGARLGFGGPQEDFRAGLDGLSRFLRERAAGR.............. 400
38 -66.5003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  17  16.....................................................................................FADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARGYGPDFGLPALRQKLSEDFYRGF-------VDAKEIFISDGAKVDLF------RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEI-IALPCLQENAFFPEFPE-----DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEH--EILILFDAAYSTFISDPSLPKSIARFCAIEINSFSKPLGFAGIRLGWTVIPQELFLSTTFNGASIPAQEAGVAGLSI--LPQLEAIHYYRENSDLLRKALLAT-GFEVFGGEH----------------------------------------------APYLWVKPTQA---------------NISDRDLFDFFLREYHIAITPGIGFGSGSGFVRFSSLGKREDILAACERLQMAPAL................... 392
39 -66.2006DK6 Entity 1(prereleased)  ali follow..  12  21.......................................................................................ARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDKGYGPEQGYDFLRNAIADNDYKAR----GLPIEADEIFISDGSKCDTGNIL------DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAG-KCTPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYAREN--GSVLLYDAAYEAFIQDPTIPHSIFRDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQA----------------LHPLWSRRHSTKFNGASYIVQKGAEALYTDEG------------KSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPA----------------GLTSWQMFDKMLNEANVVITPGSGFGSGEGYFRISAFNSRANVEEVCRRIAAL...................... 410
40 -66.1003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  17  13........................................................................................LNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGNYGWIEGSPAFKKSVSQLYT---------GVKPEQILQTNGATGANL-----LVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIE--EENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEV--GAYILSDEVYRSFSELDVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKI--------------------------------------------------------------AVDMPMEDFCLQLLQEHGVLLVPGNRFER-DGYVRLGFACEQETLIKGLEKLSQFLRRFDKEN.............. 375
41 -65.8002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  12  1............................................MAKRVNTCKCVATPQEKIEYKTKVSRNSNMSKLQAGYL---FPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHSGYGAEQGAKPLRAAIAKTFYGG------LGIGDDDVFVSDGAKCDIS------RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKN--GSIIVYDSAYAMYMSDDNPRIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLIICTCFNGASNISQAGALACLTPGLEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKN----------------------------------------------APYVWVHFPN-----------------QSSWDVFAEILEKTHVVTTPGSGFGGGEGFVRVSAFGHRENILEACRRFKQLYK.................... 426
42 -65.3003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  12  9........................................................................................FERLRALLKEITPKKRGLDLGIGEPQFETPKFIQDALKNHTHNIYPKSAFEESLRAAQRGFFKRRF----KIELKENELISTLGSREVLFNFPSFVLFD---YQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPL--TKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKH--DFILINDECYSEIYENTPPPSNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRSANAIQKASEAAWLD-DRHAEFFRNIYANNLKLARKIFKNTL---------------------------------------------------IYPYSFYVYLPVQ-------------------NGENFAKTLYQNEGIITLPALYLGRGADYVRLALVYDTPLLEKPLEIIETYREN................... 374
43 -64.2003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  14  6.....................DLGTENLYFQSMTLESMNPQ------KAVEYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYLLDSPSFPEDAKARRILQACGGGSYSASQGVNCIREDVAAYITRRD---GGVPADPDNIYLTTGASDGISTIL-----KILVSGGGKVMIPIPQYPLYSAVISELDAIQ--VNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEE--KLFLLADEVYQDNVYSPDCRFHSFKKELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKPPVSGQAAMDIVVNPPVAGEESFEQFAKKAKLTEDLFNQVPGIHCNPLQG----------------------------------------------AMYAFPRIFIPAKAVEAAQ----AHQMAPDMFYCMKLLEETGICVVPGSGFGQREGHFRMTILPPVEKLKTVLQKVKDFHINFLEK............... 490
44 -63.8003jtx_A mol:protein length:396 aminotransferase  ali model follow..  11  1................................................................................GMNTLLKQLLHEAMQGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLHEKYPLTAGLPELRQACANWLKRRY---DGLTVDADEILPVLGSREALFSF-----VQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC---PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKY--GFIIASDECYSEIYFDGNKPLGCLQQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRMSIPVQRASIAAWDD-EQHVIDNRRLYQEKFERVIPILQQVFDVKLPD------------------------------------------------ASFYIWLKVPD-----------------GDDLAFARNLWQKAAIQVLPGRFLARGEGYVRIALVADVATCVKAAEDIVSLYR.................... 396
45 -58.5001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  2...................................................................RMLSRNATFNSHGQDSSYFLGWEYEKNPYHEVHNTNGIIQMGLAENAKNPEAAAFKKNGESIFALFQDYHGLPAFKKAMVDFM--AEIRGNKVTFDPNHLVLTAGATSANETFI-----FCLADPGEAVLIPTPYYPGFDRDLKWRTG-VEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDK--GIHLISDEIYSGTAFSSPSFISVMWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQH---------------------------------------LLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRS----------NTFEAEMELWKKIVYEVHLNISPGSSCHCTEGWFRVCFANLPERLDLAMQRLKAFVGEYYNVPEVNGGSQSSHLS.. 448
46 -58.3005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  12  3.........................................................................................TQPQLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNVLWAESEQRPEAHQAYFTLLGQH-----GYPAEPGRVLSCYSSSVSM-----EILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEED-------ALHGADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEH--GTVLALDTSFRGFDAAAHAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSPLILALIREFSRDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVERVAF--------------------------------------------------------------AGRTGTEVW-EELQRHHVFALPCRQFHDGDHMVRIALSRSTEPLEKSVQVLRTVLETR.................. 376
47 -57.2006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  11  3.........................................................SSSSGLVPRGSHMHPQATPAPGAPLLD------LTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWAEEGLQATYEKRFTEAFFQLHRQPT------ALVKNKTMLSYAASIST-----MVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID----ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDH--DKLLLIDFCFASFTLFEPELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHVSPFVLNMLTQYVRSAADRLASVREVLTRNRECARKTLDGS-ILEYQEPVVKV---------------------------------------------SVAWFRVDH----------------PELTATDVHRLLSADGVYVLPGRYFYKGDAYVRMALAREPEMFADAMALTRQVLDR................... 404
48 -56.7001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  15  1....................................................................ILSKLATNEEHGENSPYFDGWAYDSDPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKANFQDYHGLPEFRKAIAKFM--EKTRGGRVRFDPERVVMAGGATGANETII-----FCLADPGDAFLVPSPYYPAFNRDLRWRTG-VQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQH--NIHLVCDEIYAATVFDTPQFVSIAKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNC--------------------------------------ARKMSSFGLVSTQTQYFLAAM-LSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPLLRESTFD----------SEMSLWRVIINDVKLNVSPGSSFECQEGWFRVCFANMDDGVDIALARIRRFVGV................... 426
49 -55.1003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  13  10..........................................................................KFTRHSGITRLMEDLNDGLRT-------PGAIMLGGGNPAHIPADYFQTLLTDMVESNYDGPQGKTALLNALAVLLRETL----GWDIEPQNIALTNGSQSAFFYLFNLFA-----ADGSTKKVLFPLAPEYIGYADSGLEDDLFVSIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQH--NIPLVIDNAYGVPFPGFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCRLSETVIKPFYYQRVQQTIAIIRRY-------------------------------------------LSEERCLIHKPEGAIFLWLWFKDLP----------------ITTELLYQRLKARGVLMVPGHYFFPGHQCMRMNYVPEPDKIEAGVKILAEEIERAWREG.............. 417
50 -53.8003if2_A mol:protein length:444 Aminotransferase  ali model follow..  13  1.........................................................GMKFSKFG--------QKFTQPTGISQLMDDL------GDALKSDQPVNMLGGGNPAKIDAELFLETYKALGNDNYSNPQGDSAFIDALVGFFNRHY----DWNLTSENIALTNGSQNAFFYLFNLFGKESKSVDKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDYRVDFEALENLKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRY--DIPLIIDNAYGMPFPNYSDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATQLSDNEIKPFYQKQATLAVKLLKQALG-------------------------------------------DYPLMIHKPEGAIFLWLWFKDL---------------PISTLDLYERLKAK-GTLIVPSEYFFPGHECIRMSIAADEQTLIDGIKVIGEVVRELYDNK.............. 444
51 -51.7003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  10  1.................................................................................MVKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVLMSYFSDMTNLELEDAIKDLHGVVG----NAATEDRYIVVGTGSTQLC-----QAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-------------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDD--EAKVIHDFAYYWPHY---TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVIGVSKESQVRTAKILNVLKETCKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWL-----------------------------------------------------GTKEETDLVSELRRHKVMSRAGERCGSDKKHVRVSMLSREDVFNVFLERLANMKLIKSID............... 390
52 -51.4001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  13  3........................................TWTMKAAEEA---------------------EAVANINCSEHGRAFECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVRMSYFFNPVSNFISFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLS-ATPDAPESKVVAHAPFYPVFREQTKYFD----------KKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRHAVI------------KGCKSIYDMVYYWPHY---TPIKYKADEDILLFTMSKFTGHSGSRFGWALIKDESVYNNLLEGTPRETQLRSLKVLKEVVAMVKTGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRR-------------------------------MRPPSPSY-------------------AWVKCEWEEDKDCYQTFQNGRINTQNGVGFEASSRYVRLSLIKTQDDFDQLMYYLKDMVKAK.................. 425
53 -49.5002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  2.........................................................AMNPLAQSLNEQLQQSNATAFAMLSDLGQNMFYPKGILSQSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDPYAPPQGIEELRDLWQQKMLRDNPE------NMSRPIVTNALTHGL-----SLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNG--ANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKAKGTKVIAVVDDAYYGLFYEDVYTQSLFTALPIRLDGATKEFFAWGFRVGFMTFGTS---------------------------DQTTKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHD-----------------VDPEALRKHLIDKYSIGVIALNATD-----IRIAFSCVEKDDIPHVFDSIAKAIDDLR................ 430
54 -46.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  13  1..............................................................SNAMPMTIKRATWNNGPDLAFDINNKANAAIEKYG----REAVINAALGTLLDDKGKSVYDRLDEMDRSSYAPIEGEKDYRKIVIDTLFGPYKPE-----GYISAIATPGGTGAIR-----SAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFANIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKDKKITLIVDVAYLEFAGDGDQQRKFFEKFVVVAFSMSKSHTAYGLRSGAAVGISSS-----------------------------------KEIIEEFEASLAHSARCNWSNGTHAAQNILIELERAEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPT--------------------DKAFDIVKDLEKENIFTIPSAKGI------RVAICGVGE---EKIPKLVQRLAFYTNKK.............. 413
55 -45.4003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  12  1.............................................................SNAMTSVAAKHAKGKKLKDVI-----VTAGQAQADAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSGYAPIAGIPDFLCAAEKECFGNFR-----PEGHIRSIATAGGTGGI-----HHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL----DEHNNFNHEAFQNRVNQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDGRNNVIIGIDVAYLDYSGEKDEVRAFFNKLTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFF--EVNKSTSRATWSNICRPAMRT--------------------------MANIVADPAKFKEYEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD-------------------SANAICEELKKEHIYVIALANGIRAACGIPKCQMTGLAEKIYNAMKSLGKL...................... 418
56 -44.5003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  14  3.......................................................................QKVDAYAGDPILTLMERFKEDPRSDK-VNLSIGLYYNEDGIIPQLQAVAEAEARLNAQPSLYLPMEGLNCYRHAIAPLLFGAD--HPVLKQQRVATIQTLGGSGALKVGADFLK---RYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWY--DEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKAR--ELIPFLDIAYQGFGAGMEEDAYAIRLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPER----------------------------------------------NFDYLLNQRGMFSYT-------------LSAAQVDRLREEFGVYLIASG---------RMCVAGLNT---ANVQRVAKAFAAVM................. 397
57 -43.7003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  3.......................................................................ENITAAPADPILGLADLFRADER--------PGKINLGQGVYKDETGKSVKKAEQYLLENNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADF-----LAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAQQGFARGLEEAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL----------------------------------------------------------------TKEQVLRLREEFGVYAVASG---------RVNVAGMTP---DNMAPLCEAIVAVL................. 396
58 -43.5004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  11  1...................................................................MAMFEHIDAYPGDPILTLNENFQKDPR--------DQKVNLSIGIYDAEGRIPVMGAVREAETKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLQTLGGSGALKVGADF-----LKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYY--DEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEAR--ELLPFVDMAYQGFGAGLDAELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYV----------------------------------------------------------KQRGMFTYTGLTESQVDALREVHGVYILRSG---------RMCVAGLNDSNVGIVADAIGKVLKSGA................ 402
59 -43.4001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  3.......................................................................ENITATTADPILGLADLFRADERP--------GKIDLGIGYKDETGKTPVLTSVKKAEQKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADF-----LAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANR----------------------------------------------DFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASG---------RVNVAGMTP---DNMAPLCEAIVAVL................. 396
60 -43.3001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  12  3.......................................................................GNLKPQAPDKILALMGEFRADPRQ--------GKIDLGVGVYDATGHTPIMRAVHAAEQKTYAGLSGEPEFQKAMGELILGDGLKSETT---ATLATVGGTGALRQALEL-----ARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYF--DAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKT--GALPLIDLAYQGFGDGLEEDAAGTRPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSD----------------------------------------------RFGFVAEHRGMFSRL-------------ATPEQVKRIKEEFGIYMVGDS---------RINIAGLND---NTIPILARAIIEVG................. 393
61 -42.9004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  1.................................................................MAVGTFENITAAPADPILGLADLFRADER--------PGKINLGIGVYDETGKTPVLTSVKKAEQKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADF-----LAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAYQGFARGLEEAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL----------------------------------------------------------------TKEQVLRLREEFGVYAVASG---------RVNVAGMTP---DNMAPLCEAIVAVL................. 400
62 -42.8002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  3.......................................................................ENITTAPADPILGLADLLRADER--------PGKIDLGMGVYDETGKTPVLTSVKKAEQKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADF-----LAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAYQGFARGLEEAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFI----------------------------------------IKQNGMFSFSGL------------------TKEQVLRLREEFGVYAVASG---------RVNVAGMTP---DNMAPLCEAIVAVL................. 396
63 -42.4002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  10  3.......................................................................ENITTAPADPILGLADLLRADER--------PGKIDLGMGVYNDETGKTPVLTSVKKAEKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADF-----LAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANR----------------------------------------------DFSFTIKQNGMFFFG-------------LTKEQVLRLREEFGVYAVASGRLNAGMTPDNLAPLC--EAIVAVL............................ 396
64 -42.2004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  14  8...........................................................AQTQGPGSMSLFSAVELAPRDPILGLNEAFNADTR--------PTKVNLGVGVYTNEDGKIPLLRAVRDAERGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALGGTGALKIGADF-----LRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYY--DAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKAR--RLVPFLDIAYQGFGESIEADAAAVRLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIER----------------------------------------------DFSFINAQRGMFSYS-------------LTSAQVDRLREEFGIYAVSTG---------RICVAALNT---RNLDVVANAIAAVLK................ 414
65 -42.2005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  11  1...................................................................SSWWTHVEMGPPDPILGVTEAFKRDTN--------SKKMNLGVGAYRDDNPSVRKAEAQIAAKKEYLPIGGLAEFCKASAELALGENSEVLKSGFVTVQTISGTGALRIGASF-----LQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYY--DPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKR--NLFAFFDMAYQGFASGDGRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTH----------------------------------------------NWQHITDQIGMFCFT-------------LKPEQVERLIKEFSIYMTKDGRISAGVTSSNVGYLA------HAIHQVTK....................... 401
66 -41.9004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1.........................................................................MAMGKPDPILGLGQDFRMDPA--------KRKVNLSIGVYDDADQPFVLECVKQATLMDYAPVTGIASFVEEAQKLCFGPTCAALRDGIASCQTLGGTGALRIGGDL-----LNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYY--DPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRR--NHIPFVDMAYQGFATGQLDHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVH----------------------------------------------DWSHIERQVGMMAYT-------------LTREQVELLRSEYHIYMTLNG---------RAAVSGLNSTNVEYVSQAIHNVTK................... 390
67 -41.5003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  12  5.......................................................................THVEMGPPDPILGVTEAFKRDTN--------SKKMNLGVGAYRDDNGKPYAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGFVTVQTISGTGALRVGASF-----LQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYY--DPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKK--NLFAFFDMAYQGFASGDGDHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSH----------------------------------------------NWQHITDQIGMFCFT-------------LKPEQVERLTKEFSVYMTKDGRISAGVTSGNVGYLA------HAIHQVTK....................... 401
68 -41.4004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  12  2.............................................................AMGTLEAQTQGPGSMGKPDPILGLGQDFRMDPA--------KRKVNLSIGVYDDADQPFVLECVKQATLMDYAPVTGIASFVEEAQKLCFGPTCAALRDGIASCQTLGGTGALRIGGDL-----LNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYY--DPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRR--NHIPFVDMAYQGFATGQLDHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQV-------------------------------------GMMAYTGL---------------------TREQVELLRSEYHIYMTLNGRAASGLNSTNVEYVS------QAIHNVTK....................... 403
69 -41.0001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  10  3.......................................................................ENITAAPADPILGLADLFRADER--------PGKINLGIGLYYDETGKIPVLTSVKKAEKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRV-----AADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAYQGFARGLEEAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANR----------------------------------------------DFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASGRVNAGMTPDNMAPLC--EAIVAVL............................ 396
70 -40.6003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  10  1............................................................................MQPVLVFKLTADFREDPDPRK-VNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNHEYLPILGLAEFRSCASRLALGDD--SPALKEKRVGGVQSLGGTGALRIGADFLAYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR---GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHR--FLFPFFDSAYQGFASGNLEYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQI-------------------------------------GMFSFTGL---------------------NPKQVEYLVNEKHIYLLPSGRINSGLTTKNLDYVAAVTKIAENLYFQSDYKDD................... 413
71 -40.5001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  3.......................................................................ENITAAPADPILGLADLFRADER--------PGKINLGIGVYDETGKTPVLTSVKKAEQKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADF-----LAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIK----------------------------------------------------------QNGMFSFSGLTKEQVLRLREEFGVYAVASG---------LVNVAGMTP---DNMAPLCEAIVAVL................. 396
72 -39.9003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  12  12...........................................................................................ARNTMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQREYQPDGS--LLSQATAEFYADRY----GYQARPEWIFPIPDVVRGL-----YIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT------GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRY--DARVLVDEIHAPLVFDGQGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSNPSDAE-----------------------------------------HWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRIPGAPMQATYLMWIDFRDTT-----------------EGSPSEFFIEKAKVAMNDGAWFGDGTGFCRLNFATSREVLEEAIDRMAKAVSHH.................. 376
73 -39.6004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  11  1.................................................................MAVGTFENITAAPADPILGLADLFRADERPGK--------VDLGIGYKDETGKTPVMTSVKKAEQKTYLGLDGLPEFGRCTQELLFGKG--SALINDKRARTAQTPGGSGALRV---AADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEK--GWLPLIDFAYQGFGRGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQN-------------------------------------GMFSFSGL---------------------TKEQVLRLREEFGVYAVASG---------RVNVAGMTP---DNMAPLCEAIVAVL................. 400
74 -39.2001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  11  3.......................................................................ENITTAPADPILGLADLLRADER--------PGKIDLGMGVYNDETGKSVKKAEQYLLENNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADF-----LAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK--GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQN-------------------------------------GMFFFGGL---------------------TKEQVLRLREEFGVYAVASG---------RLNVAGMTP---DNLAPLCEAIVAVL................. 396
75 -38.9003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  11  24......................................................................................................EELIHAWIADMDFEVPQPIQTALKKRIEHPYTLPPE--NIGDIICNWTKKQY----NWDIQKEWIVFSAGIVPAL-----STSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPL-QKQNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKY--NVIVVADEIHSDIIYADHSLSEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQAFT----------------------------------------SIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHIPTLKPEGSFLLWIDCSAL---------------NLSQDERTKLLEEKGKIIVEPGEKYGGGEEHIGINIGCPRSVLEEILNRLRHTFS.................... 383

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24