current user: public

If you have questions about the server, please let us know.

Query: 3a2b_A mol:protein length:398 Serine palmitoyltransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst SKGKLGEKISQFKIVEELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVETLILast
1 -115.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model  100  1SKGKLGEKISQFKIVEELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVETLI 398
2 -109.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  34  4....LSKFDPLIAEREALLATGVRDPYAIVKVLSPTEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGTAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVIP.. 399
3 -108.0001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  29  1....MSWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPC-PGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG......... 384
4 -107.0001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  36  2SHMRGEFYQQLTNDLETARAEGLFKEERIITSAQQADITVDGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVI... 400
5 -107.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  31  2...AMHLLDTLAEGLKEIDARGLRRRRRTADTPCAAHMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASDAD-VKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA..... 396
6 -106.0003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  38  1SNAMQEILSQLNKEIEGLKKAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKRFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI... 399
7 -106.0005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  31  1....MNLLDTLQRGLADLDAQGLRRVRRTADSACDAHMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACTSQ-TKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA...... 393
8 -105.0002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  35  24....LSKFDGLIAERQKLLDSGVTDPFAIVQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIGL. 420
9 -103.0003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  29  18TRAGLSPLAWLADIEQRRRAEGLRRELR---------VRPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAART-EERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELAT----IAGVTEAPVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR..... 397
10 -103.0004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  35  40....LSKFDGLIAERQKLLDSGVTDPFAIVQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIGL. 436
11 -103.0004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  26  21.........NLQDKYTQYQRDNLLRELT---------PFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDG-----KSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIR... 391
12 -101.0002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  28  1....MDYNLALDKAIQKLHDEGRYRTFIDIEREKGARPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA..... 401
13 -99.5005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  25  10QESGFDYEGLIDSELQKKRLDKSYRYFNNINRLAKAHRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLPRV. 435
14 -97.3002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  24  12...............NKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHG---PGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF.... 386
15 -95.3003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  24  26...............NKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHG---PGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF.... 400
16 -30.0002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  12  1............................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCT-TPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTTPENFAQTIEETKKRGEVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS..... 371
17 -23.8004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  1............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR....... 333
18 -23.4003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  16  1............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSREQLAEVAAHWRAFLAR....... 333
19 -22.8002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  18  3........................................SDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPRNIHRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILNLKVNAHGFIEALRNSGVLA-------NAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS..... 349
20 -22.7005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  52....................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNLEDKGKGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFDELKKRGIAGVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK..... 411
21 -21.9003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  15  2........................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--------EVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ---QHVVRLADDHRRARQLAEGLAALPLDLAQVQTNMVFLQL-TSGESAPLLAFMKARGILFS---------GYGELRLVTHLQIHDDDIEEVIDAFTEYLGA....... 341
22 -20.7003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  13  1.................MSLIPLRQNIASMKGYIPGYQPPDIASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG-----RIAGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAESNALELVRRHENV-----VVTRTLSKSYSLAGGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDRD-GKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE........ 353
23 -20.5004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  13  36..........................................KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPEN---------HDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKAYGLAGGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASRAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA..... 374
24 -20.4001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  11  2...............................STPRTTATAAKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSEHPKLVYISTQYTKQ----ELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS....... 357
25 -20.3003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  15  27..........................................NVDIRLNTNE---YPPSEALVADLVATVDKIATELN---------RDAVELRDELAAYITKQTGLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGA--DMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYA-----SPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGYFVANPAFIDAVMLVRLPY----HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNF--VFFGDFSDQHAAWQAFLDRGVLIRDVGIAGH------LRTTIG---VPEENDAFLDAAAEIIKL....... 364
26 -20.3003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  36.......DVQRNENFGKLRAGYLFPEIARRRKAH--QEKNPDAKIISLGIGD--TEPLPKYIADAMAKAAAGLATREGYSGYEQGQGALREAVASTFYGHAGRADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHKRTDIIFFCSPNNPTGAAATLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGGWTVVPKALKYANGEPVHADWCFNGASNIVQAGGLACLQ-LKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDVFAEILER---CNIVTTPGSPAGEGFVRASAFG--SRENILEAVRRFKEAYGKRN..... 441
27 -20.2001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  10  25..........................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAY-YHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDIRGL 437
28 -20.1004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  13  32..........................................AVPVRLNTNE---HPPTRALVDDVVRSVRE-----AAIDLHRYPDRDAVALRADLAGYLTAQTGIWAANGSNEILQQLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRAN--DVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYG-----SSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGYLIATPAVIDAMLLVRLPY----HLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANF--VLFGEFADAPAAWRRYLEAGILIRDVGIPGY------LRATTG---LAEENDAFLRASARIATDL...... 370
29 -20.0004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  14  23..........................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKAYGLAGGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSR--TQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSD....... 353
30 -19.9006DK6 Entity 1(prereleased)  ali follow..  12  4..........INENFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGD--TEALPEAVRYAMHEAVDELGNRSTFKGYEQGYDFLRNAIADNDYKARGLPDEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVGFVPDIPQEKADLIYLCYPNNPTGAVATLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGAYVVIPKSLMGRKKNGEAQALHPNGASYIVQKGAEALYT--SQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPY-VGCPAGLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFN--SRANVEEVCRRIAAL.......... 410
31 -19.9003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  12  14.....................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQKELHPIETILVGAADRLMTLDEIKALPDIACLLLELP---EIGGVAPALETISRYCRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL...... 352
32 -19.9003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  15  3.............................TQPESAAFTAPSTDNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDIEGLKAAVAAYSG--PSIVYLVNPNNPTGTITPADVIEPWIAS-NTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNF--VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI.... 354
33 -19.8003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  15  30..........................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNLDEKKLYETHKDEIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLYGLGGGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDEKN-STDLSEKLLKKGIIIRNLKSYGLN-----IRITIG---TSYENEKFFTEFDKILR........ 365
34 -19.6002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  15  16EKIEYKTKVSRNSNMSKLQAGYLFPEIARRRSAH--LLKYPDAQVISLGIGD--TEPIPEVITSAMAKKAHELSTIEGYSGYEQGAKPLRAAIAKTFYGGLGIGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENRTDIIFFCSPNNPTGAAATLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVA-METASFSKYAGFTGGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEK---THVVTTPGSPGGEGFVRVSAFG--HRENILEACRRFKQLYK........ 426
35 -19.4001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  19  22.................................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLHRP---KLIVAAA--SAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLVSGGTDLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAV-GLEEMDEIAAIIGLVLKN....... 386
36 -19.4003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  13  22...........................................................PRNVGVLTEALQNIDDNLESD--IYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADENRRVAYHPLSHLEIHEQKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPALEKISEYCHEQGISLHLDGARLWEITPFYQKSAEE---ICALFDSVYVSFYKGIGGAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFE---KRIGKMAEYFEAAKGLAERFNSCSTVPEVPVSNMFHVYFENSADEIGLTKIQDETGVGISGYLQEKS-ADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL...... 359
37 -19.3003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  16  17...................SAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVP----RAVLQAQGSVLNKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEFRP---KVIIAGW--SAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKGGTDVHLVLVDLRDSPDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAL-GDTEFTEVADIIATALAT....... 407
38 -19.2004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  17  2.....................EYSDVPKFIRDVSIKQHEWMRESIKLIASENITS----LAVREACATDFHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPDADAMVKKILEEKP---KLILFGG--SLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVDFTESHQVIIDIDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEC-KEKEMEEIAEFMKRIAID....... 392
39 -19.2003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  14  27....................................RLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQEN-AFFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--LPQLEAIHYYRENSDLLRKALLATGFEVFGGEHALWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLG--KREDILAACERLQMAPALQS..... 394
40 -19.1006MME Entity 1(prereleased)  ali follow..  10  25..........................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGSMANMRAVRELTEAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDIRGL 437
41 -19.0002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  14  28.............................FGKTMGRKIEHGPLPLINMAVGI--DGPTPQGIIDHFQKALTIPENQKYGA--FHGKEAFKQAIVDFYQRQYNVTEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVA-IEIYSLSKGYNMSGGFAVGNKDMIQALK-KYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIY-LETPPGYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLAL--DDQKLDEAAIRLTELAYLYE..... 398
42 -19.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  14  18...................................RKARERGVGLIDLSIGS--DLPPPEAPLKALAEALND---TTYGYCLKSCTLPFLEEAARWYEGRYGVGEALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADKAVPEGVWREAKVLLLNYPNNPTGAVADFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERV-VELFSLSKSYNLAGGFALGSEEALARLE-RVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGVALAP------PGGKGFVRIALVR--PLEELLEAAKRIREALD........ 376
43 -19.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  17  2............ASMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTS----PAVMAAQGSQLNKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGAHGGHLTHGSPVNMSGKWFNVVSYGDYDAAEKLANEHKP---KLIVAGA--SAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAG-----VYPNPVPHADFVTTTTHKSLGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEKEYQQKVVENARVLAETLVKRGLRIVSGRTEMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAGFGPAEAEQVGNLIADVLEN....... 393
44 -19.0006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  16  48........................................SGAYLTDPDGRRWIDFDGDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHGYHCDEPFTPNQHGIVEFLFDLDVLAEWLSRPEQ---AAVVISPDHMHLGE---YTEFTRLTKEADVPVIADEV----KVGLRYRAGLSTPLLDPAV----WIVAKCLA--NGSVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATG-EPQQAIRAAGDRFIAHTRAAGVPILAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAALT..... 389
45 -18.8006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  14  29........................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPER---AAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERLA..... 372
46 -18.8003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  13  16..........................................AQAVCLAFNE---EAVEPRVQAAIAAAAARINRYPFDAE---------PRVMRKLAEHFSCPDNLMLVRGIDECFDRISAEFSSMRFVTAWGYRARIAVSGLRHFEIGLTDDLLLDPNDL------AQVSRDDCVVLANPSNPTGQALSAGELDQLRQR--GKLLIDETY-VDYSSFRARGLAYGENE-----LVFRSFSKSYGLAGGALFGPSELIAAMKRKQWFC----NVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENAAGE---RTLRFLRERGIQVKDAGQFGLHH----IRISIG---REEDNDRLLAALAEYSDH....... 336
47 -18.7003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  16  5....................SYITKQDKVIAEAIEREFQRQNSNIELIASENFVS----EAVMEAQGSVLNKYAEGYPGRRYYGGCEVTESIAIDRAKALFGAEHVNV--SGPQANMAVYLVALEMGDTVLGSHGGHLTHGAPVNFSGKFYNFVEYGNYDEVRKLALEHKP---KLIVAGA--SAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAG-----LHPNPVEYADFVTTTTHKTLGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNKTYQQQVVKNAKVLAEALINEGFRIVSGGTDAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKTSGIRLGTPAGFDEKAFEEVAKIISLALKN....... 390
48 -18.7001v72_A mol:protein length:356 Aldolase  ali model follow..  13  5........................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHINNDECEFFSNGAKLMTVDGDIVRLRERTREKVGDVHTVSITQAIYTLD----EIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAE-MTWKAGVDALSFGATKNGVLAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTD-----RNARKANAAAQRLAQGLEGLG--LGGTEANILFCRLDSA-----MIDALLKAGFGFY-----HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ..... 354
49 -18.7004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  14  37.......KLVRNVNLEKLKNNYLFPEINRRELEH--IEKHPNVQLISLGTGD--TEPIPEQITSHMSNFAHGLSTVEGYRGYEQGNKTLRKAIAETFYRDLHVKNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKGPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVA-IEVSSFSKFAGFTGGWSIIPDELLPIINDFHR--IVTTSFNGASNIAQAGGLACLSSGGSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGSKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFG--RRDHIVEASKRLQNFFNTRT..... 443
50 -18.7003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  1............SNAMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTS----PRVMQAQGSQLNKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGAQGGHLTHGSPVNFSGKLYNIVPYGDYDEMAKLAKEHKP---KMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEKVYQQQVAKNAKAMVEVFLNRGYKVGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAGFKEAEVKELAGWMCDVLDN....... 395
51 -18.6001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  15  9..........................................HQFPGLANKTYFNFGGQGILPTVALEAITAMENGPFSIAANQHIQQLIAQLRQALAETFNVDPTITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIFGITYRFFPV---ATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGRVLVDGAQSAGSLPLDFSRL--------EVDYYAFTGHKWFGPAGGGLYIHGDCLGEINPTYVGW-FEVATSAPQYAGLLAALQLHQRAEERYQAICQRSEFLWRGLNQLPLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDC------IRACCHYITDEEEINHLLARLADFG......... 389
52 -18.5006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  14  45........................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPER---AAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERLA..... 388
53 -18.3002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  12  23................................................EKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEELIEKILSYLDTDNNVSVGNG---ADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTK----DLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERILKT-GAFVALDEAYY------HGESYVDFLKKYENL-AVIRTFSKAFSLAAGYVVASEKFIDAYNRVRLPF----NVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEE-KERLLEHLRTKNVAVRSF--------REGVRITIG---KREENDMILRELEVF.......... 340
54 -18.2005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  12  4...........................................KSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHVETDECEFFSNGSKLLTAASTPQSIREVALKRQDIHKPRVVTITQATEVGTVYRLKAISATCKELGLNLHMDGARFTNACAFLGCSPAE-LTWKAGVDVLCFGGTKNGMAGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE------RHGNHANHCAQLLALLVSDLP--MFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT........ 345
55 -18.2006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  10  55........................................................ASQQSIVSRLPQLWYE-----------GLQATYEKRFTEAFFQLHRQNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDIYPELERRVRTDALFLVDPNNPTGFSLLFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYELLENSGLAIEDTGKTWPVQDALITASDDIWETVYNLHTSVLLNV--SPFVLNMLTQYVRDSAADASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFHPELTATDVHRLLSADGVYVLPFYWSEPSKGDAYVRMALAR--EPEMFADAMALTRQVLDRHG..... 406
56 -18.2001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  16  26.................................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEIVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLEPGDTVLGAHGGHLTHGSPVNFSGKLYNIVPYGDYADLEKQAKEHKP---KMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRVGTPAGFKEAEAKELAGWMCDVLDS....... 392
57 -18.1003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  18  3............SNANPFFSQSLAERDASVRGAILKELERQQSQVELIASENIVS----RAVLDAQGSVLNKYAEGYPGKRYYGGCEEVEALAIERVKRLFNAGHANV--SGAQANGAVMLALAKPGDTVLGDAGGHLTHGAKPALSGKWFNALQYGDYDQVEALAQQHKP---SLIIAGF--SAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLGPRGGFVLNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDKTYIDRVLANAQALGDVLKAGGVDLVTGGTDLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKTSGIRLGTPAG-GAAEFREVGRLILEVFEA....... 396
58 -18.1003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  16  3...................AMSLEMFDKEIFDLTNKELERQCEGLEMIASENFTL----PEVMEVMGSILNKYAEGYPGKRYYGGCEEIETLAIERCKKLFNCKFANV--SGSQANQGVYAALINPGDKILGSHGGHLTHGAKVSSSGKMYESCFYGVELDYEKVREIAKKEKPKLIVCGA--SAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAG------HPSPFPYAHVVSSTTHKTLGPRGGIITNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEKVYAKQVRTNAQVLANVLMDRKFKLVSDGHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSTSGLRLGTPAGFKEKEMEIVSNYIADILDD....... 388
59 -18.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  5...................NNNLHETDKEINEIIKHEKLRQSSVIELIASENFVS----PAVLEAQGALLNKYAEGYPSKRFYNGCEKAENLAIERVKKLFNCKYANV--SGSQANQAVYLALLQPGDTVLGDSGGHLTHGAAPNMSGKWFNAVSYSDYDEIERLADLHKP---KLLIAGF--SAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATG-----EHQSPIPYAHAVTSTTHKTLGPRGGLISNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEKSYIQQVISNAKALASSLQERGYDILTGGTDVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSTSGIRLGTPAC-KEKDFVLVGHMVADILDG....... 391
60 -18.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  18  22.................................................QREGLELIASENFVSKQVREANKYAEGYPGARYYGGCERVESLAIERAKALFGAAWANV--SGSQANMAVYMALMEPGDTLMGAAGGHLTHGSRVNFSGKLYKVVSYGDLEEVRRLALEHRP---KVIVAGA--SAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLGPRGGLISNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEKEYSRLVVENAKRLAEELARRGYRIVTGGTDFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPTSGIRIGTPAGFTPEEMPLVAELIDRALLEGPSEAL. 393
61 -17.9001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  16  3.........GLSRRVQAMKPSATVAVNAKALE-----LRRQGVDLVALTAGE--DFDTPEHVKEAARRALAQ---GKTKYAPPAGIPELREALAEKFRRENGLEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVERVRRAITPRTKALVVNSPNNPTGAVEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGR---VAPEHTLTVNGAAKAFAMTGGYACGPKEVIKAMASVSSQS--TTSPDTIAQWATLEALTNQEASEMAREAYRRRRDLLLEGLTALGLKAVRPSGAVLMDTSPIAPDEVRAAERLLEAGV---AVVPGTDFAAFGHVRLSYAT--SEENLRKALERFARVLGR....... 384
62 -17.9002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  15  30...................................MAARRRGEDIIDLSMGN--DGPTPPHIVEKLCTVAQREDTHGYST--SRGIPRLRRAISHWYRDRYDVQEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVEFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGGFMVGNPELVSALA-RIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMIPEPYAHLGSLEFAKKLLQDAKVSVSP------DYGDDHVRFALIE--NRDRLRQAVRGIKAMFRADGLLS.. 402
63 -17.9005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  16  4...................AYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTF----PSVMEAMGSILNKYAEGYPNKRYYGGCEKIESLAIERAKKLFNCQFANV--SGSQANNAVYHALLKPYDKILGSCGGHLTHGAKVSLTGKHYQSFSYGVNLDYEEALKIAQSVKPEIIVCGF--SAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTN-----EHAHPFPHCHVVSSTTHKTLGPRGGIILTNEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSTSGIRIGSAAGMGAKEFEIIGNKISDILND....... 389
64 -17.9002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  14  19................................ALAQKLESEGKKVIHLEIGE--DFNTPKPIVDEGIKSLKE---GKTHYTDSRGILELREKISELYKDKYKADNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDFT-----VESLEEALSDKTKAIIINSPSNPLGEVID-REIYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFDENLEKT-ILINGFSKLYAMTGGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETEREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYY-VFPNIGEDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYAN--SYENIKEGLERIKEFLNK....... 370
65 -17.9003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  11  21........................................PKKRGLDLGIGE--QFETPKFIQDALKNHTH----SLNIYPKSAFEESLRAAQRGFFKRRFKIENELISTLGSREVLFNFPSFVYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPSLNEKELQEVDLVILNSPNNPTGRTLSLISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMLAGN--LVIHSLSKRSSAPGGFIAGDSRLLEKYKAFRAYL--GYTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNTLIYPYS-------VYLPVQNGENFAKTLYQNEGIITLPLYLGRNRIGADYVRLALVY--DTPLLEKPLEIIETYRENHA..... 376
66 -17.7003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  13  21................................EAARRAEEAGRRIIHMEVGQ--GTGAPRGAVEALAKSLET---DALGYTVALGLPALRQRIARLYGEWYGVGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADFAGLDLAGLMVASPANPTGTMAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALE----LTDECYVINSFSKYFSMTGGWMVVPEDQVRVVERIAQNMF--ICAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAGIAPPDGAFYVYADVSDLTDDSRAFAAEILEKGVAVTPGLDFDPERGAGTLRFSYAR--ATADIEEGLDRLEAFMQARG..... 383
67 -17.7003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  16  33..................TAKDVWSLTNEAAAKAANNSKNQGRELINLGQ-GFFSYSPPQFAIKEAQKALDIPMVNQYSP--TRGRPSLINSLIKLYSPIYNTENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVEELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGGWVLSLNAELLSYAAKAHTRICFASPSPLQEACANSINDALKIGEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVILNKGKDFRISHWLINEGVVAIP-IKEHEKAAENLLRFAVCK--DDAYLENAVERLKLLKDYL...... 447
68 -17.7001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  17  1........MALSDRLELVSASEIRKLFDIAA---------GMKDVISLGIGE--DFDTPQHIKEYAKEALDK---GLTHYGPNIGLLELREAIAEKLKKQNGIEEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRDELKKYVTDKTRALIINSPCNPTGAVKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGGFVAAPSWIIERMKFQMYNATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAIFPRIRDTGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYAT--AYEKLEEAMDRMERVLKERKLV... 389
69 -17.7005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  16  1..............MAMFANISISEFDPELAQAIASEDERQEAHIELIASENYCS----PAVMEAQGSKLNKYAEGYPGKRYYGGCEVIEQMAIDRAKELFGADYANV--AGSQANSAVYLALLNPGDTVLGAHGGHLTHGAKVSFSGKTYNAVQYGDYEEVERLALEHKP---RMIVAGF--SAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAG-----VYPNPVQIADVTTTTTHKTLGPRSGLILAKANIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDKAYQQQVVKNAQAMAEVFIARGYDVGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSTSGIRIGTPAGFGEAEVRELAGWIADVIDS....... 393
70 -17.7003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  12  7.DEKLIREKQNELHIKDLGMASIRDLVALVTNLEKA----TGTKFCRMEMGV--GLPAPQIGIETEIQKLREGVASIYPN--LDGLPELKQEASRFAKLFVNIDRACVPTVGFVSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSHPGEPLYQPSDNYILALSSSKAFSYAGGVLMISGKLYEREYPDLEESFLSSGATHSAQWGMAAMLKACNDGEDSVIEYGRKARIMKKMFLDNGFNIVYDKDGNEPLVGYKGMDSSKLIEKFVRYGMCAIT------SKRNEAMRICTSLL-PESQFPDLEKRLQMLNAE....... 436
71 -17.6001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  11  33......................................LAAQYKPLNLGQ-GFPDYHAPKYALNALAAAANSPDPLANQYTRGFGHPRLVQALSKLYSQLVDRTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGGWAYGPEALLKNLQMVHQNCVYTCATP-AIAVGFETELKRLKSPESISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVA-TDARKDYRFTKWMTKSGLQGIP-SEPNKHLGEDFVRYCFFK--KDENLQKAAEILRKWKGS....... 428
72 -17.6002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  14  28..........................................EEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAY-YALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNYFFDTTQGHSQINGDLEGLERGIEEVGPNNVPYIVATITSNSAGSLANLKAMYSIAKKYDIPVVMDSAENAYFIKQREAEYKDW-ETYKYADMLAMSAKKDAMVMGGLLCMKDDSFFDVYTECRGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRI-AQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPACELYKVAGIRAVEI---QLPCPAELLRLTIRATYTQTHMDFIIEAFKHVKENASNIKGL 452
73 -17.6005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  11  2............................TTQPQLKENLTQWAYLALNSELN---DGHARQALSPGQQKIVNE--AESEQRPVQQIESEAHQAYFTLLGQHAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGAD--LSAELLSSVGCVFVTTPNNPTGRVLALRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLQEAGCRW-VVIEDTGKLWPTLDGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSRDAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSVERVAFAGRTGTEVWEELQRHHVFALPFHWAEPSDGDHMVRIALSR--STEPLEKSVQVLRTVLET....... 375
74 -17.6001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  13  2................................................SRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIARMVEMAGLMGIAHHAYDCGEVARPDVQAIDAILNADPTISHIAMV-----TTTGMLNPIDEVGALAHRYGKTYIVDAMSSFG---------GIPMDIAAHIDYLISSANKCIQGVPGFVIAREQKLAACKGHSRSLSLDLTSPTHTVLAFAQALKELAKEAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITDPQYRFSEFYRRLKEQGFVI----YPGKVSQSDCFRIGNIGEVYAADITALLTAIRTAMYWTK..... 366
75 -17.6001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  14  21......................................LAQRLGAVNLGQGF--SNPPPPFLLEAVRRALG----RQDQYAPPAGLPALREALAEEFA--VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVRELEAIARLARAHDLFLISDEVYDELYYGERPRRLRE---FAPERTFTVGSAGKRLEATGGWIVGPKEFMPRLAGMRQWTSFSA--PTPLQAGVAEALKLARREGALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPGWDAFRL---VEEARVLIPASAFYLEDPPKDLFRFAFCK--TEEELHLALERLGRVVNSPR..... 372

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.