current user: public

If you have questions about the server, please let us know.

Query: 3aq5_A mol:protein length:121 Group 1 truncated hemoglobin, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MNKPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGKLast
1 -70.7003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model  100  1MNKPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK 121
2 -65.9002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  32  10.REPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSG 129
3 -65.6001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  35  1.....SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT. 115
4 -65.6001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  34  10.REPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSG 129
5 -61.4002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  19  2.....TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNV 121
6 -61.1006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  35  1....STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPE 121
7 -61.1004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  32  5.APADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGT 128
8 -60.4001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  47  2....STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ 124
9 -60.2002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  47  1....ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVRNDVLNR 123
10 -60.0004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  21  19.TPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQ 144
11 -59.9001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  42  39RKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNM 161
12 -58.6005d1v_A mol:protein length:127 Globin  ali model follow..  29  2..SEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNR 123
13 -58.1002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  19  1MSSETTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQ 128
14 -57.8001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  20  2...PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNS 126
15 -57.4004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  19  31.DDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNV 154
16 -57.2002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  25  1.EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNT 123
17 -57.2005v3t_A mol:protein length:132 Globin  ali model follow..  23  1MSKQPTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNT 125
18 -50.3001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  23  1MGQSNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQ 124
19 -48.4004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  17  47VKFPSKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINR 172
20 -48.2004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  18  22.IDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAG 147
21 -45.4002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  13  1......MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEE-MKNVILQRAQMIASHFQNM 120
22 -18.3001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  14  3MNAADRVMQSYGRCCASTGFFDDFYRHFLASPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSY 131
23 -14.4002w31_A mol:protein length:162 GLOBIN  ali model follow..  14  29.............ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSNRYIHNKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI....... 138
24 -14.3001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  11  59.............QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVDEFIEKRNRSIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI....... 168
25 -14.0004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  11  27.............VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVD-IQHTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS....... 138
26 -14.0004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  11  32.............VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQVDDVERTVAEVHARIGIPVE-FRVLKKILYPVIFSSDYSAAEKLQVYHFSINS....... 143
27 -13.7004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  12  32.............TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAAPT-FQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV....... 145
28 -13.6004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  13  74.............TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSDD-QQKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET....... 187
29 -12.7005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  14  34.............APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPEAYWDRRYRRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV....... 145
30 -12.0002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  10  50.............EDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSQAWLDYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA....... 177
31 -11.6003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  17  21.................DEAGLLFYRRLFDEPKVRPLF-KIDIEKQGRKLMDVLNWIVLNLQDIDARELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE 132
32 -11.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  20  22.................NEIGLLFYANLFKEPTVSVLFQN-PISSQSRKLMQVLGILVQGIDNLEGQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE 133
33 -10.6002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  15  21.................EDLTNEFYKIMFNYPEVKPMFNMQISGEQPKALAMAILMAAKNIENLENDKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYID. 132
34 -9.9901vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  16  22.................VTITTTFYKNLFAHPEVRPLFDRQESLEQPKALAMTVLAAAQNIENLPAKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQV 136
35 -9.7901gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  12  5.QEERDEISKTFQGTDMKTVVTQALDRMFKYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDKDLSKKHADLHVDPGSFHLLTDCIIVELAYLCFTPHIQGIWDKFFEVVIDAISKQ 134
36 -9.6901bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  13  19.............KANIPQYSVVFYTSILEAPAAKDLFTNPKLTGHAEKLFALVRDSAGQLKASG-AALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK. 142
37 -9.6101cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  5.EDQEHYIKGVWKDVDHKQITAKALERVFVYPWTTRLFSKANDIGVQQHADKVQRALGEAIDDLKKQNLSGKHQEIGVDTQNFKLLGQTFMVELALHTFRPKEHAAAYKFFRLVAEALSSN 139
38 -9.5101jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  11....ASTWKDIAGADNGAGVGKECLSKFISHPEMAAVFGDPGVAELGAKVLAQIGVAVSHLGDEG-KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALIS. 143
39 -9.4801eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  1LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFGTAPFETHANRIVGFFSKIIGELPNIEANTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK 135
40 -9.1501jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  10  11....ASTWKDIAGSDNGAGVGKECFTKFLSHHDMAAVFSDPGVADLGAKVLAQIGVAVSHLGDEGKKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALIS. 143
41 -9.1303mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  11  5.QEERDEIVKTFFSANSSAIGTKALERMFVFPWTNAYFAKXXXFSASIHAAIVVGALQDAVKHEDDVNISKAHAKLHIDPGSFHLLTDSFIVELAHLAFTPFVFAVWIKFFQVVIDAISSQ 134
42 -9.0201kr7_A mol:protein length:110 Neural globin  ali model follow..  17  2..............VNWAAVVDDFYQELFKHPEYQNKFGFKGVALGSLKGNAAYKTQAGKTVDYINAGLASRHKGRNVGSAEFHNAKACLAKACSA......................... 93
43 -9.0204f68_A mol:protein length:110 Neural hemoglobin  ali model follow..  18  2..............VNWAAVVDDFFQELFKHPEYQNKFGNAAYKTLAGKVVDYINAWIGG----DAAGLASRHKGRNVGSAEFHNAKACLAKACSA......................... 93

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.